KEGG   Acinetobacter baumannii AYE: ABAYE2413Help
Entry
ABAYE2413         CDS       T00667                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:aby00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ABAYE2413
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aby02044]
    ABAYE2413
Secretion system [BR:aby02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABAYE2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP DUF3880
Motif
Other DBs
NCBI-ProteinID: CAM87263
UniProt: B0VB03
Structure
PDB: 

Position
complement(2461269..2461772)
Genome map
AA seq 167 aa AA seqDB search
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDM
VFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNE
EGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSNNTASYAA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatatacgttgagtttcgcggtaaatataaagttgatggagagtctcgtgat
tctgagcacaaaggttggttagaagttaactcttggtctcataacatccgtcaacctaaa
tctgctacttcaagtagtgtgggcggccacactgctgaacgtgttgaacattctgacatg
gttttcgtgaaagacttagacgcaactagccctaaattatgggaagcttgttcagctggt
tatacatttgatgaagtacaaatcgacttctatcgcgcaaatggcgataaacgtatcaag
tacttacaaatcaaattgaagcacgttttagtttctagtgtgactccaactgttaacgaa
gaaggcgttcctacagaagcattcggtttgaaatatgctgctgttgagtggacttataac
caacaagatattaacggtactgctaaaggagctgttactaagaaatggtcactttctaat
aatacagcttcttacgcagcgtaa

DBGET integrated database retrieval system