KEGG   Acinetobacter baumannii AYE: ABAYE2777Help
Entry
ABAYE2777         CDS       T00667                                 

Gene name
ureB
Definition
(GenBank) urease beta subunit
  KO
K01429  urease subunit beta [EC:3.5.1.5]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00220  Arginine biosynthesis
aby00230  Purine metabolism
aby00791  Atrazine degradation
aby01100  Metabolic pathways
aby01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aby00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ABAYE2777 (ureB)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ABAYE2777 (ureB)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    ABAYE2777 (ureB)
Enzymes [BR:aby01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     ABAYE2777 (ureB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_beta
Motif
Other DBs
NCBI-ProteinID: CAM87608
UniProt: B0V9P6
Position
complement(2796133..2796441)
Genome map
AA seq 102 aa AA seqDB search
MIPGEVITPETDIELNVGRETLKVVVANLGDRPIQVGSHFHFYEANDALQFDREAVKGFR
LNIAAGTAIRFEPGQSREVEIVALAGKREVYGFAGRVMGKLD
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgattcccggtgaagttattactccagaaactgatattgaactaaatgttggacgagaa
actttaaaggttgtggtggctaatcttggcgacaggcctattcaagtcggttcgcatttt
catttctatgaagcaaacgatgccttacagtttgatcgtgaggcagtcaaaggttttcgg
ttaaatattgcagcaggcacagcaatacgttttgaaccgggacaaagtcgagaagtagag
attgttgctttagctggtaagcgagaagtatatggttttgctggtcgggtaatgggcaag
ctggattaa

DBGET integrated database retrieval system