KEGG   Acinetobacter baumannii AYE: ABAYE2928Help
Entry
ABAYE2928         CDS       T00667                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00010  Glycolysis / Gluconeogenesis
aby00030  Pentose phosphate pathway
aby00051  Fructose and mannose metabolism
aby00052  Galactose metabolism
aby00230  Purine metabolism
aby00500  Starch and sucrose metabolism
aby00520  Amino sugar and nucleotide sugar metabolism
aby00521  Streptomycin biosynthesis
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABAYE2928 (algC)
   00030 Pentose phosphate pathway
    ABAYE2928 (algC)
   00051 Fructose and mannose metabolism
    ABAYE2928 (algC)
   00052 Galactose metabolism
    ABAYE2928 (algC)
   00500 Starch and sucrose metabolism
    ABAYE2928 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    ABAYE2928 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    ABAYE2928 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABAYE2928 (algC)
Enzymes [BR:aby01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ABAYE2928 (algC)
    5.4.2.8  phosphomannomutase
     ABAYE2928 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAM87750
UniProt: B0V8Y7
Position
complement(2953890..2955308)
Genome map
AA seq 472 aa AA seqDB search
MNVRHSFPKNIFRAYDIRGKLSYLTTDVVRSIAYGLAQQYKQAEQTQLIIGYDARLTSPA
YAHLIEEILVEQGLNVTNIGCCSTPMMYYIAREFGGNGIMVTASHNPKSDNGIKWILRGE
PPSPEMIQQVGEFAQTYVPTHTISLLELSTPQFNSEFCKKYQQAIFNDIQLKRPLKVVLD
GLHGSAGHCSKLVLEKMGCEVIALRTTPNGEFPDHAPDPSHAAHLKELRKTIIEQGADIG
IALDGDGDRVVLLDEKANILTADRLLSLFAQMCLEQQPDKEIVFDVKCSLMVQRTVERLG
GKPKMIRTGSSFLRAYLSQSNGNAIFGGEYAGHYVFNDGRGFGYDDGLYAALRVMEYFTE
SSATTISDLFSNYPERCCTEDTYIGTHQSDPKHVLQDIEILSHRLGARISKIDGVRLDFD
DGFGIIRASNTGEYFTVRFDADNPLRLKEIQQKFIDMLQERYPQIAQELSEA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagacactcatttccaaaaaatattttccgtgcttacgatattagaggcaaa
ctttcttatttaactacggacgtcgtccgttcaattgcctatggattggcacaacaatat
aaacaagcagaacaaactcaactgatcattggttatgatgcgcgcttaacgagtccggct
tatgcgcatttaatcgaagagatattagtagagcagggtttaaatgttacaaatattggt
tgttgctcaaccccgatgatgtactacattgcacgggagtttggtggtaatggcataatg
gtaacagctagccataaccctaaatcagataatggtattaaatggattttaagaggtgaa
cctccatctcctgaaatgatccagcaagtaggtgaatttgcgcaaacatatgtacctact
catacaatttcattattagaattatcaactcctcaatttaattcagaattttgtaaaaaa
taccaacaagcaatctttaacgatattcaacttaagcgtcctttaaaagttgtattagat
ggcctgcatggatcggcagggcactgctcaaaactcgtacttgaaaaaatgggctgtgaa
gtcattgctttacgtacaactccaaatggtgagttccctgatcatgcaccagacccttca
catgctgcgcatttaaaagaactacgtaaaacgattattgaacagggggcagatattggt
attgcccttgatggcgatggcgaccgtgtcgtattgcttgatgaaaaagccaatatactt
accgctgaccgtttattgtcactatttgcacaaatgtgtctggagcagcaaccagacaaa
gaaattgtatttgatgtgaaatgctcactcatggttcaaagaaccgtagaacgacttggt
ggtaaacccaaaatgattcgcacgggaagtagcttcctccgcgcgtatttatctcaatca
aatggtaacgccatttttgggggcgaatacgcgggtcattatgtatttaatgatgggcgt
ggttttgggtatgacgatggtttgtacgctgcattacgtgtaatggaatatttcaccgag
tcgagtgcgacaacaatttctgatttattttctaattatcctgaaagatgctgtaccgaa
gatacttatattggcacccatcagtccgaccctaaacatgtactacaagatattgaaatt
ttaagccatcgtttgggtgctcgaattagtaaaattgatggcgtacgtcttgattttgat
gatggttttggcattattcgagcatcaaatacaggtgagtattttaccgtaagatttgac
gctgataatcctttacgtttaaaggaaatccagcaaaaatttattgatatgttgcaagag
cgttatccgcaaattgcacaagaactttctgaggcctaa

DBGET integrated database retrieval system