KEGG   Acinetobacter baumannii AYE: ABAYE2973Help
Entry
ABAYE2973         CDS       T00667                                 

Gene name
rluD
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D (Pseudouridylate synthase) (Uracil hydrolyase)
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
aby  Acinetobacter baumannii AYE
Brite
KEGG Orthology (KO) [BR:aby00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aby03009]
    ABAYE2973 (rluD)
Enzymes [BR:aby01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     ABAYE2973 (rluD)
Ribosome biogenesis [BR:aby03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ABAYE2973 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 DUF2660
Motif
Other DBs
NCBI-ProteinID: CAM87794
UniProt: B0V8G9
Position
complement(3000860..3001912)
Genome map
AA seq 350 aa AA seqDB search
MTSAQSSNTNFSETDFNLLEDSEDADNHTSDTTATRLSLQVQLDESYLGQRIDQVAAMVW
SEFSREKLKQWMKEGHLLVNGNIVKPKYRCEGNETLTLNVELEAQTNSQPENIPLDIVYE
DEDILVINKPVGMVVHPGAGNTSGTLVNALLYHSPKSAELSRAGLVHRIDKDTSGLLVVA
KNLEAQFSLSKQLGDKSVYRIYDLVTYGNIIAGGTIDEPIKRHPVDRVKMAILPGGRDAV
THYNVKERFRDFTRVQAQLETGRTHQIRVHFSYIGHGLVGDQVYMNRVRIPAGASELLIE
TLRGFKRQALHAAKLGLKHPRTGEEMLFEAPWPEDFTQLVNVLRTENAAY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagcacaatcttcaaacacaaacttctctgaaacagacttcaatttactagaa
gattctgaggatgcagataaccatacttctgatacaactgcaacacgtttatcgttgcaa
gttcagttagatgaaagctacttagggcaacgtatcgaccaagtggcagccatggtgtgg
agtgagttttcacgcgaaaaacttaaacaatggatgaaagaaggtcatctgttggtaaat
ggtaacattgtcaaacctaaatatcgctgcgaaggcaatgaaacgctaactttaaatgtt
gagcttgaagcacagaccaacagtcaaccagaaaatattccactcgatattgtttacgaa
gatgaagatattttagtcattaataaaccggtaggtatggtggttcatcctggcgcaggt
aatacctcgggtactttggtcaatgctttgctttaccattcacctaagtcagccgagctt
tcacgtgctggtctagtacatcgtattgataaagataccagtggtttactagttgttgct
aaaaatctcgaagcacaattttctttgagtaaacaattaggagataaatctgtttatcgt
atttatgacttagtcacttatggcaatattattgcaggtggcacaatcgatgagccgatt
aaaagacatccggttgaccgtgtaaaaatggcaattttgccgggtgggcgtgatgctgta
acgcactataacgtgaaagagcgttttagagactttactcgtgtacaagcgcaacttgag
actggccgtacccaccagattcgcgttcactttagttatattggacatggtttggttggt
gaccaagtttatatgaaccgtgtacgtattccggcaggggcatctgagttactcatcgaa
actttacgcggttttaaacgccaagcacttcatgctgctaaattgggattaaaacaccct
cgtactggtgaagaaatgttattcgaagcaccatggcctgaagattttacgcagttggtt
aatgttttacgtacagaaaacgctgcatattaa

DBGET integrated database retrieval system