KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00067Help
Entry
ABZJ_00067        CDS       T01820                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00562  Inositol phosphate metabolism
abz00564  Glycerophospholipid metabolism
abz00565  Ether lipid metabolism
abz01100  Metabolic pathways
abz01110  Biosynthesis of secondary metabolites
abz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:abz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ABZJ_00067
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ABZJ_00067
   00565 Ether lipid metabolism
    ABZJ_00067
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ABZJ_00067
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:abz02042]
    ABZJ_00067
Enzymes [BR:abz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     ABZJ_00067
Bacterial toxins [BR:abz02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   ABZJ_00067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: AEP04527
Position
1303862..1306030
Genome map
AA seq 722 aa AA seqDB search
MNRREFLLNSTKTMFGTAALASFPLSIQKALAIDAKVESGTIQDVKHIVILTQENRSFDN
YFGTLKGVRGFGDRFTIPMTEGRKVWEQYDANKKKVLPYHLDSRLGNAQRVTGTNHSWSD
GQGAWDNGRMSDWVAHKQPQSMGYYKKQEVEYQFALANAFTICDAYHCAMHAGTNPNRKF
IWTGTNGPTGAGVASVVNEFDGIGPSTEGYEWTTYPERLQQAGVTWKVYQNMPDNFTDNP
LAGFKQYRRANEQSGQPVSNDTLMCPAYDEKIDVTQPLYKGIANTMPDGGFLGTFKADIA
QGKLPQVSWLVAPATYSEHPGPSSPVQGAWYIQEVLNALTENTQVWSQTVLLVNFDENDG
FFDHVPSPSAPSKDINGVVYGKTTLTDQQVSYEYFNHPAVATSKSQPETDGRVYGPGVRV
PMYVISPWSRGGWVNSQVFDHTSILQFLEKRFGVQEPNISPYRRAVCGDLTTAFNFKTPN
LLPVGELDGKKTKAEADAIRVAQELLPQVSVPSQQQFPQQEIGIRPSRALPYILHTSAKV
DATQKTVKLMFSNTGKQAAVFHVYNRLDLTAIPRRYMVEAGKQLDDVWNTINGQYDLWVL
GPNGFHRAFKGNLSQANQTQALPEIRVCVEECDANLYLKVRHDGNKSVKLTVKANAYLPN
KIWMIETNSSEKELVWDMSEFGGWYDFTVTLAEDATFSRRFAGRIETQEDSISDPYMGYL
ES
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcgcgaatttcttttaaattctacaaaaacaatgtttgggaccgctgctctg
gcgagtttcccgctgagtattcaaaaagcgttagcaattgacgccaaagttgaaagtgga
actattcaagatgttaaacacattgtgattttgactcaggaaaaccgttcatttgataat
tattttggaacactcaaaggtgtacgtggtttcggcgaccgttttaccattcctatgaca
gaaggccgaaaggtttgggaacaatatgatgctaataaaaagaaagtattgccataccac
ttagatagtcgtttaggaaatgctcagcgtgttactggtacaaatcattcatggtcagat
ggtcaaggtgcttgggataatgggcgtatgagtgattgggtagcgcataaacaaccgcag
tcgatgggctactacaaaaaacaagaagttgaatatcaatttgccttagcgaatgctttt
acgatttgtgatgcctaccactgtgccatgcacgcgggaactaacccgaaccgtaaattt
atctggacgggaaccaatggccctacaggtgcaggtgttgcgagtgtggtcaatgaattt
gatgggattggaccatcaacagaaggttatgaatggacgacgtatcctgagcgtttacag
caggctggcgtgacatggaaagtttatcaaaacatgccggataactttactgataaccct
ttagctggtttcaagcaatatcgccgtgcaaatgagcaatctggtcaacctgtcagtaac
gacacactaatgtgtccagcatatgatgaaaagattgatgtgactcaaccactttacaaa
ggtattgccaataccatgccggacggtggttttctaggaacttttaaagctgatattgcg
caaggtaaattaccgcaagtgagttggttagttgctcctgcaacttacagtgaacatccg
gggccatctagtcctgtacaaggcgcttggtatattcaggaagtattaaatgcattaact
gaaaacactcaagtgtggagccaaaccgttttattggtgaacttcgatgaaaatgacggt
ttctttgaccatgttccttcaccaagcgcaccttctaaagatataaacggtgttgtatat
ggaaaaaccactttaacggaccaacaagtatcttatgaatactttaaccatccagcagtg
gcgacttcaaaatctcaacccgaaacagacggacgggtgtatggcccaggtgtacgcgtt
ccaatgtatgtgatttcgccgtggagccgtggaggatgggtaaattctcaagtctttgat
catacttctattttacaattcttagaaaaacgttttggtgtgcaagaacctaacattagc
ccataccgccgtgctgtatgtggtgatttaacaacggcatttaattttaaaacaccgaat
cttttgcctgttggtgaactagatgggaagaaaacaaaagccgaagccgatgcgattcgt
gtcgctcaagaactattgccgcaagtttctgttccgagccagcaacaatttcctcagcag
gaaataggaattcgaccttcgcgtgctttaccttatattttgcacactagtgccaaagtc
gatgccactcaaaaaacggttaagctgatgttctccaatacgggtaaacaggcagccgtt
ttccatgtctataaccgtttggatcttacggcaattccacgccgttatatggttgaggcg
ggtaaacagcttgatgacgtgtggaatactatcaatggacagtatgatttatgggtactt
ggaccaaatggttttcaccgtgcgtttaaaggtaatttaagtcaagctaatcagactcaa
gcattaccggaaattagagtatgtgtagaagaatgtgatgcgaatttatatttaaaagtg
cgtcatgatggtaataagtcagtcaagctcactgtcaaggcaaatgcttatctgccaaac
aagatatggatgatagaaactaatagttctgaaaaagaactggtttgggatatgtctgaa
tttggtggttggtatgactttacggtgacattagcggaagatgcgacgtttagtcgccgt
tttgcagggcgtatagaaactcaagaagattcaatttctgatccatatatggggtattta
gaatcttaa

DBGET integrated database retrieval system