KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00093Help
Entry
ABZJ_00093        CDS       T01820                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00040  Pentose and glucuronate interconversions
abz00052  Galactose metabolism
abz00500  Starch and sucrose metabolism
abz00520  Amino sugar and nucleotide sugar metabolism
abz01100  Metabolic pathways
abz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABZJ_00093
   00052 Galactose metabolism
    ABZJ_00093
   00500 Starch and sucrose metabolism
    ABZJ_00093
   00520 Amino sugar and nucleotide sugar metabolism
    ABZJ_00093
Enzymes [BR:abz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ABZJ_00093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEP04553
UniProt: G2JKK0
Position
103220..104095
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSVISVRQPQPLGLGHAVLCAKSVV
GEDDFAVLLPDVLVKDGSGQNDLSRMISRYNSSQAAQIMVEAVPDHLVDQYGIVDVKHSP
NVGESIAMQGIVEKPAVGAAPSNLSVVGRYVLPTKIMQLLENTPKGAGNEIQLTDAIAML
QDTDTVEAYRMQGQTFDCGSKLGYLKAVLHYGLEHPKLGMEFKQLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaggcagttttacctgttgccggtttaggcacacgttttttaccagcaagt
aagtcaattcctaaagaaatggtaacagtagttgaccgtcctgcaattgaatatgtagta
cgtgaagctgtagaggctggaattgagcaaattattttagtcactcattcatcgaaagcc
tcaattgaaaattattttgataggaactttgagttagaaacgactttagaacaaaagaaa
aaattcgacttacttgcagagattacacaaattgtgcctgagcatgtaagtgtaataagt
gttagacagcctcaacctttaggtttaggacatgctgttttatgtgcaaagagtgttgtc
ggcgaagatgattttgcagtgctattaccagatgtactcgtgaaagatggctctggacaa
aatgatttatctcgtatgatttctcgttataactcaagccaagctgctcaaatcatggtt
gaggcagtgccagaccatttagtagatcaatatgggattgtcgatgtaaagcatagccca
aatgtgggtgaaagtattgccatgcagggtattgttgaaaagcctgcagtaggcgctgca
ccatcaaacctatctgtggttggccgctatgtgttacctaccaagattatgcaattactt
gagaacacgccgaaaggtgcaggtaatgaaattcagttaactgatgcaattgcaatgctt
caagacacagatactgttgaagcttatcgtatgcaaggccaaacgtttgactgtggtagt
aagcttggttatttaaaagctgtattacattatggcttagaacatccaaaattaggaatg
gaatttaaacagctgattcaagaacttaaattataa

DBGET integrated database retrieval system