KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00107Help
Entry
ABZJ_00107        CDS       T01820                                 

Gene name
acnD
Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00640  Propanoate metabolism
abz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ABZJ_00107 (acnD)
Enzymes [BR:abz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     ABZJ_00107 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AEP04567
Position
1354474..1357080
Genome map
AA seq 868 aa AA seqDB search
MNTKYRKPLAGTQLEYYDVRQAVEDIQPGAYEKLPYTSKVLAEQLVRRADAENLTAYLTQ
LIERRQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGDPSKVNPVVPTQLIVDH
SLAVEYGGADPDAFAKNRAVEDRRNEDRFHFIEWTKTAFKNVDVIPAGNGIMHQINLEKM
SPVIQARDGVAFPDTCVGTDSHTPHTDALGVISVGVGGLEAENVMLGRASWMRLPDIIGV
ELVGQRQAGITATDIVLALTEFLRKERVVGAYLEFFGEGADSMSVGDRATISNMTPEYGA
TAAMFYIDQNTIDYLRLTGREDAQVALVEQYAKEIGLWASEMTKAEYPRVLRFDLSTVTR
NIAGPSNPHARVSTSDLKEKGIAGVVENRSDGLMPDGAIIIAAITSCTNTSNPRNTVAAG
LLARKANELGLTRKPWVKTSFAPGSKAAALYLEEAGVLKDLEQLGFGIVAYACTTCNGMS
GALDPVIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDI
EKDALGHDKEGNPIYLKDIWPSDAEIDALVKEAVKPEQFRKVYIPMFDLGEVEQAKSPLY
DWRPQSTYIRRPPYWEGALAAPRTLANMRPLAILGDNITTDHLSPSNAILMDSAAGEYLH
KMGVPEEDFNSYATHRGDHLTAQRATFANPKLYNEMVRRSDGTIKQGSKARVEPEGEVMR
MWEAIETYMNRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGM
GVLPLEFKPGVNRKTLKLDGTELYSVIGNIAPRSTLTLVIERATADGKEEILEVPVTCRL
DTEEEVSVYEAGGVLQRFAQDFLEGQVA
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaataccgtaaaccgctggcaggtacccagcttgaatactacgacgtgcgt
caagccgttgaagatattcagccaggcgcatacgaaaaactgccttacacctctaaagta
ctcgcagagcaattggtacgccgtgccgatgccgagaacttaactgcttatttaacgcag
ttgattgaacgccgtcaggacttggactttccttggtatccagcgcgcgtggtgtgtcat
gacatcttgggtcaaactgcattggttgaccttgcaggtttgcgtgatgcgattgctgag
aagggcggcgacccatctaaagttaacccagttgtaccaacacagctcattgtcgaccac
tctttagcagtggaatacggtggtgctgacccagacgcttttgcaaaaaaccgtgctgtt
gaagaccgtcgtaacgaagaccgtttccactttattgagtggaccaaaactgcatttaaa
aatgtcgatgtgatccctgcggggaacggcattatgcaccagattaacctagagaaaatg
tctccggtgattcaggcgcgtgatggcgtagcattcccagatacatgtgtcggtacagac
tcacacacaccacatacagacgccttgggcgtaatttctgtgggtgtaggtggtttagaa
gctgaaaacgtaatgttgggccgtgcatcttggatgcgtctgccagacattattggtgtt
gagttggttggtcagcgtcaggcaggcattactgcaacagatatcgtacttgctttaacc
gagttcttgcgtaaagagcgcgtagtgggtgcttaccttgagttctttggtgaaggcgct
gacagcatgtctgtgggtgatcgcgcaaccatttcgaacatgacaccagaatatggcgct
acggctgcgatgttctacattgaccaaaacacaatcgactacttacgcctaacaggccgt
gaagatgctcaagtggcattggttgaacagtacgcaaaagaaatcggcctttgggcatct
gaaatgaccaaagcagagtacccacgtgtactacgttttgatttatcgacagttacacgt
aacattgctggtccatcaaacccacatgcacgtgtttcaaccagcgacctaaaagaaaaa
ggcattgcaggtgtagttgaaaaccgttctgacggcttaatgccagatggcgcaatcatt
attgctgcaattacttcatgtaccaatacttctaacccacgtaacaccgtggcggcaggc
ttgttggcacgtaaagcaaatgaacttggcctaacacgtaaaccgtgggtgaaaacctca
tttgcaccgggttcaaaagcggctgcactttaccttgaagaagcaggtgtcctaaaagac
ttagaacaacttggttttggtattgtggcttacgcttgtacgacctgtaatggtatgtct
ggtgcgttagatccagtcatccaacaagaaattattgaccgtgacttgtacgcaacagca
gtactttctggtaaccgtaacttcgatggccgtatccatccatatgcaaaacaagcattc
ttggcgtctccaccgcttgttgtggcatatgcaattgcgggtacgattcgttttgacatc
gaaaaagatgcgttaggtcatgacaaagaaggtaacccgatttacctcaaagacatttgg
ccatctgatgctgaaattgatgccttagttaaagaagccgtgaagcctgaacagttccgt
aaagtttacattccgatgtttgacttgggcgaagtcgaacaagcgaagagcccactttac
gactggcgtccgcaaagtacttacatccgccgtccaccatattgggaaggggcgttggct
gcaccacgtactttagcaaacatgcgtccacttgcgattttgggtgataacatcaccacc
gatcacttgtcgccttcaaacgcgattttgatggactcggctgcgggtgaataccttcac
aaaatgggcgtaccagaagaagacttcaactcatatgcaacgcaccgtggtgaccacttg
actgcacaacgtgcaacatttgccaacccgaaactctataacgaaatggttcgccgttca
gacggtaccattaagcaaggttcaaaagcgcgtgtagagccagaaggcgaagtgatgcgt
atgtgggaagcaattgaaacctacatgaaccgtaagcagccgttaattattatcgcgggt
gctgactacggtcagggttcaagccgtgactgggctgcaaaaggtgtacgccttgcaggt
gtagaagcgattgtggcagaaggttttgagcgtattcaccgtactaacttggtgggtatg
ggcgtgttaccgcttgagtttaaaccgggtgtaaaccgcaagactttaaaactagatggt
acagagctttatagcgtgattggtaatattgcgccgcgttcgactttaactttagtgatt
gaacgtgccacagcggatggtaaagaagagattcttgaagtgcctgtgacttgccgttta
gatacagaagaagaagtttctgtatatgaagcgggcggtgtattacagcgttttgcgcaa
gactttttagaaggccaagtggcttaa

DBGET integrated database retrieval system