KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00227Help
Entry
ABZJ_00227        CDS       T01820                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00051  Fructose and mannose metabolism
abz01100  Metabolic pathways
abz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ABZJ_00227
Enzymes [BR:abz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ABZJ_00227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AEP04687
Position
complement(1486656..1487432)
Genome map
AA seq 258 aa AA seqDB search
MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDHGHDAGLAGQITCRSEN
KETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANRFHTWIYKEHPEVNCIIHT
HPTYVAALSMLQIPLMISQMDVCALYEDCSFVGHWPGVPVGNEEGILISSALGKNRAVLL
SHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIPHALAAEAHDWVSTDKRNK
VNFAYYARKALKKHSDCI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcttctgtaaacaaacacgacttgatgcaacacgcacagcaagacatgcaa
aagtggattagcgacttagatttaacagaccgtcaaaagcttgcactgacttgccgtatt
ttatttgatcatgggcatgacgctggtttagcgggtcaaattacatgccgtagtgaaaat
aaagaaacctttattactcaacgtttcggtttaggttttgatgaaattactgcttcaaac
ttgcttgaggtgaatcaggacttagaacccatcaatcaagaaggcatggcaaacccagcc
aaccgtttccacacatggatttataaagaacacccagaggtgaactgtattatccatacg
catcctacctatgtagcggccctgtcgatgctacagattccacttatgatttcccaaatg
gacgtctgcgcactttacgaagattgctcatttgtaggccattggccgggtgttcctgta
ggcaacgaagaaggtattttgatttcttctgctctgggtaaaaaccgcgctgttttgttg
tctcaccacggtcaactggtcacaggaaaaactatcgaagaagcctgtaacttggctctt
ttaattgaacgcgcagctcaactgcaacttttagccatgtctgccggacaaatccagcct
atcccccacgctttggcagcagaagcccatgattgggtgtctactgataaacgcaacaaa
gtgaactttgcttactacgcacgtaaagctttgaaaaaacattctgactgtatttaa

DBGET integrated database retrieval system