KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00312Help
Entry
ABZJ_00312        CDS       T01820                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00860  Porphyrin and chlorophyll metabolism
abz01100  Metabolic pathways
abz01110  Biosynthesis of secondary metabolites
abz01120  Microbial metabolism in diverse environments
Module
abz_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABZJ_00312
Enzymes [BR:abz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ABZJ_00312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 FMN_red
Motif
Other DBs
NCBI-ProteinID: AEP04772
UniProt: G2JCI8
Position
339388..340155
Genome map
AA seq 255 aa AA seqDB search
MLFINTRPDSRAAELTHALQNKGFQVESLPLLELVAQPFSESLSQLYQQLTGAQAIVVVS
PTAVDVGMQYLTQSGLKIDELKHIQWIAVGQATANRLHDYGIEAHVPEVETSEGMLNLPL
LHHMQKSGSVAFWRGEGGRQFMMETLQQQGIQILNFVLYRRQCPQASYSTFKHLTQNSNY
NLDKWLVLITSEASWKYWLELCLKNKAQPDCVYLVLGPRLFQLVKDYRDQQQAHFHIIQL
ENLSPSGMIHHIQAL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttattaatacccgacctgactcgcgtgcggctgaattaactcatgctttgcag
aataaggggtttcaggtcgagtctttacctcttttagaactggttgctcaacctttttca
gaatcactctctcaactctatcagcagttaactggcgcacaagcgattgtagtggttagt
cccactgctgttgatgtggggatgcagtatttaacacaaagtggtttaaaaatagatgag
ctaaaacatattcaatggattgcggtggggcaggcgacggctaatcgtcttcacgactat
gggattgaagcgcatgttcctgaggttgaaacttccgagggaatgcttaacttgcctctt
cttcatcatatgcaaaaatcaggtagtgtggctttttggagaggggaaggcggccgtcaa
tttatgatggaaactttgcaacagcaaggaattcagattttaaattttgttctatatcgc
cggcagtgtccgcaagcttcatattcgacattcaaacatctgacacagaattcaaattat
aatttagataaatggctcgtcttaattaccagtgaggcgagctggaaatactggttagag
ctttgtttaaaaaataaggcacaacctgattgcgtatatttagttttaggaccacgcctt
tttcaacttgttaaagactatcgcgatcagcaacaagctcattttcacattattcaactt
gaaaatttatcgccttcggggatgattcatcacattcaggcattataa

DBGET integrated database retrieval system