KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00779Help
Entry
ABZJ_00779        CDS       T01820                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00450  Selenocompound metabolism
abz00970  Aminoacyl-tRNA biosynthesis
abz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ABZJ_00779
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABZJ_00779
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abz01007]
    ABZJ_00779
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abz03016]
    ABZJ_00779
Enzymes [BR:abz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ABZJ_00779
Amino acid related enzymes [BR:abz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ABZJ_00779
Transfer RNA biogenesis [BR:abz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ABZJ_00779
 Prokaryotic type
   Other AARSs
    ABZJ_00779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 tRNA-synt_1d Ofd1_CTDD
Motif
Other DBs
NCBI-ProteinID: AEP05239
Structure
PDB: 

Position
complement(2090851..2092914)
Genome map
AA seq 687 aa AA seqDB search
MRKILVTNALPYANGPIHMGHLLGYIQADIWVRAMRAMGHDVTYVCADDAHGTAIMLRAE
ANGISPEEQIANVQKEHIRDFDGFGVHFDHYDSTHSDANKARSTDIYIKNREAGNIAVRP
VTQLFDPEKGMFLSDRFIKGTCPKCKSEDQYGDSCEVCGTTYNATELLNPRSTLSGATPV
EKSSDHYFFKLPNFAEYLQKWTRDEGRLPLSIANKLDEWFEAGLADWDISRDAPYFGFEI
PDAPNKYFYVWVDAPIGYMSSFENYIKTKRPDLNFDDFWKKDSQNEVYHFIGKDIVYFHA
LFWPAMLEGANYRTPTGLFVNGFLTVNGQKMSKSRGTFIKAETYLQHLNPEYLRYYFASK
LSDKVEDSDLNLDDFVQKVNSDLVGKVVNIASRCAKFINSSFNNTLSSTCAESDLVQSFI
DAGDSIAAAYEAREFSTAIREIMALADRANQYIDEKKPWALAKQEGQEQQVLDVCSVGIN
LFRQLAVYLAPVLPTLAQQVQDFLKLESFDFESRKQILVSHEIAQFQPLMQRVDPKAVAA
MVDASKESLGAPAPQATKSAKKEKSAEKKAAPTPAVGEAEIIGIEDFLKVDLRVAQVVEA
GTVEGSDKLLQLTLDVGEAEPRNVFSGIRSQYAPEDLKGKLVVMVANLAPRKMRFGISNG
MVLAAGNGEGIFIISPDSGAKPGDKVS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaattttagtcaccaatgccctcccttatgccaatggtccaattcatatgggt
catttactcggttatatccaggcagacatctgggttcgtgccatgcgggcaatgggtcat
gacgtgacttatgtatgtgcggatgatgctcacggtacagcaattatgctacgtgccgaa
gcaaatggtattagcccagaagagcaaatcgcgaatgttcaaaaagaacacattcgtgat
tttgatggttttggcgtacatttcgatcattatgattcaactcatagtgatgcgaacaaa
gctcgttcaacagatatctatattaaaaaccgtgaagctggcaatattgcagtccgacct
gtaactcaattatttgatccggaaaaaggtatgttcttatctgaccgtttcattaagggt
acttgcccaaaatgtaagtcagaagatcaatacggcgactcatgtgaagtatgtggtaca
acttataatgcgactgagttactcaatccgcgttcgactttaagtggtgcaacaccagtt
gaaaaatcatcagatcactatttcttcaagctcccaaactttgctgaatatttgcaaaaa
tggacccgcgatgaaggtcgcttacctctttcaattgctaacaaattggatgaatggttt
gaagcaggtttagcagactgggatatttctcgtgatgctccttattttggttttgaaatt
ccggatgcaccgaataaatatttctatgtgtgggtagatgccccaatcggttatatgtct
agttttgaaaactatatcaaaactaagcgcccagatttaaactttgatgatttctggaag
aaagatagtcaaaatgaggtttaccactttattggtaaagacattgtttacttccatgct
ttattctggcctgcgatgcttgaaggggcgaactatcgcactccaacaggcttattcgta
aatggtttcttgactgtaaatggacaaaaaatgtctaagtctcgcggtactttcattaaa
gccgagacatacttacaacatctaaacccagagtatttacgctattactttgcttctaaa
ctttcagataaagttgaagactctgacttgaaccttgatgactttgttcagaaagtaaat
tcagatttagtgggtaaagtggttaatattgctagtcgctgtgctaagtttattaacagc
agttttaacaatacgctatcaagtacatgtgctgaatctgacttagtacaaagctttatt
gatgctggtgattcaattgctgctgcatatgaagcgcgtgaattctctacggcgatccgt
gaaattatggcgcttgctgaccgcgcaaaccaatatattgatgagaaaaaaccttgggct
ctggctaaacaagaaggtcaagaacaacaagttcttgatgtatgctctgtcggtatcaac
ttattccgtcaattagcagtgtacttagctccagtactgccaactttagctcagcaagtt
caagatttcttaaaacttgaaagcttcgatttcgagtcacgtaaacaaattcttgtaagc
catgagattgcacagttccaacctcttatgcagcgtgttgatccaaaagctgttgcagcc
atggttgatgcttctaaagagtctttaggtgctcctgctccacaagcaactaaatcagcg
aaaaaagagaaatctgccgagaaaaaagcagcccctactccagcagttggtgaagctgaa
attattggtattgaagacttcttaaaagttgacttacgtgttgctcaggtcgttgaggca
ggtacagttgagggttcagataaattacttcaattgacgttagacgtaggtgaagctgaa
ccacgtaatgtatttagtggtattcgtagtcaatatgcgccagaagacctaaaaggaaaa
ttggtcgttatggtggctaaccttgcaccacgtaaaatgcgttttggtatttcaaacggt
atggtacttgctgccggaaatggtgaaggtattttcattatttcaccagatagcggtgca
aaacctggcgataaagtttcttaa

DBGET integrated database retrieval system