KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01454
Entry
ABZJ_01454        CDS       T01820                                 

Gene name
tssB
Definition
(GenBank) type VI secretion system contractile sheath small subunit
  KO
K11901  type VI secretion system protein ImpB
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Brite
KEGG Orthology (KO) [BR:abz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abz02044]
    ABZJ_01454 (tssB)
Secretion system [BR:abz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABZJ_01454 (tssB)
SSDB
Motif
Pfam: T6SS_VipA DUF29
Other DBs
NCBI-ProteinID: AEP05914
UniProt: A0A654KXY3
Position
2753376..2753879
AA seq 167 aa
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDK
KFINVDLDNIDEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPL
KKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKLSAEADHE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctaagagagaaagcgtacaaaagaagcttcagcgaattcgacctcctcgtgttcag
cttacatatgatgtcgaaattggtgatgcgaaagaagcgaaagaactaccattcgttgta
ggtgtaatgggtgatttttcagctgcatctgagcttgagcgtacaaaattaaaagataaa
aaattcattaatgtcgatttagataatattgatgaagtaatggaatctctgtctccaaga
gctgcttttcaagtagacaatacgttgacagaagaaggcggtaaaatggcagttgattta
acgtttaagtcaatggaagattttcgcccggaaaatgttgtacagcaagttgatccatta
aagaaattggttgaggcgcgtgagcgtttaaccgatttaagaaacaaaatttcaaacagt
gagcgtttagaagatctgcttgatgaggttcttaaaaatactgatcaaatccgtaaatta
agtgccgaggccgatcatgaataa

DBGET integrated database retrieval system