KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01458
Entry
ABZJ_01458        CDS       T01820                                 

Gene name
tssF
Definition
(GenBank) type VI secretion system baseplate subunit TssF
  KO
K11896  type VI secretion system protein ImpG
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Brite
KEGG Orthology (KO) [BR:abz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abz02044]
    ABZJ_01458 (tssF)
Secretion system [BR:abz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABZJ_01458 (tssF)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEP05918
UniProt: A0A654KYD4
Position
2756479..2758290
AA seq 603 aa
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI
DKKLTDSYDVFTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRS
FKGVQCEFNTTQEVKLLPIHLSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEK
LPIYLDAISNFPLQVLDSIFKKGTSFAVKYGQTIVELSKNPFELIGFAEQESLLPLDQHT
HHAYRLLMEYFCFPEKFSYLKLDLDFLRRLPQHVSEFELLIHFKLNLNDQAVVRNYSELN
IANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILEMNMVREKTNQ
EESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSL
NSLALMKGDAVSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGV
KAELQIDSSVFRGHSLYIFSQLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGK
TLL
NT seq 1812 nt   +upstreamnt  +downstreamnt
gtgatagaagagcttttaccgttttatgaaaaacaattacaagaatttggtcaacaatct
cgagaatttgcccaaaaatatccaaaaattgctcagcgcttatctttaaatcaagagcaa
attgatgacccacatattgaacgtctgattcaggctttttcgctgattgctgctcgaatc
gataaaaaactaacagacagttacgatgtttttactcgttctttatttgaggtgatgttc
cctcaatacttacggcattttcctgcgtgttcagttgttagctttgaagatattaataag
attaaacagcttacagaacctcatcttgtacctcatcatacggttttgaaatctcgtagt
ttcaaaggagtacagtgtgagtttaatacaactcaagaggttaaattactacctattcat
ttaagtggtttagattttaaaactacacctagtgcacatatgcacttaaatcaaaatgcg
acgttgagccttaaatttgaaatttttaataatgctcatgcttgtttaactgatgagaag
cttcctatttatttggatgctatctctaattttcctctacaggtccttgatagtattttc
aaaaaaggaaccagttttgcggttaaatatggacaaacaattgtagaattgagcaagaat
ccatttgaattgattggttttgcagaacaagaaagtttattaccgcttgatcaacatacc
catcatgcttatcgtttgttgatggaatacttttgtttcccggaaaagtttagttatctt
aagctcgatttggattttttaaggcgactacctcagcatgtatccgaatttgagctttta
attcatttcaaattaaacttaaatgatcaagccgttgttagaaactattctgagctaaat
attgcaaactttaaattatttactacccccgtaattaatttatttgaaaaatatgctgaa
ccccagaagatagttcacaagcaattagaatatcctttagttacagacgctcaccatcct
gaattttatcaagtatattcaatacttgagatgaatatggtgcgtgaaaaaacaaatcag
gaagaaagctatgttcctgttttgcctttttttgcgatgagccattaccacaatgataca
gctcgctttttttactcagtaaactatcaaaagttacagtccaatttcgttgaaatgggc
tattcgattatttctaaaaatttaaatccattttcaacgcgctcagattttattagcact
aaattattatgttcaaaccgtgatttacctcatgaagcactgggtcagtctaataacgta
ttaaatttaaatgatagtagcttggcgagacgtgccattgttttaaaacgacctacaaag
ccttataagtttgaacaaggccaaagtgaacagtggcgtgtgatctcgcatctttcatta
aatagcttagcacttatgaaaggggatgctgtttctcatgttaaagagctgctggcttta
tataacttaccgcagtcaaaagaaaactatttaattatagaatcaattaaaaaattagaa
ttttctcttacccataaactcgtagatggcaaaccatttccaatgtttgtaagaggagta
aaagctgaattacaaattgattcatccgtatttagagggcatagcttatatatttttagt
cagttattaagtcgtgtttttaatttaaaggttcaaattaatagttttgttgatttggtg
gttaaggattattcatctcagcaggagttataccaatgcagtcagaacgttggtggcaag
actcttctgtaa

DBGET integrated database retrieval system