KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01552Help
Entry
ABZJ_01552        CDS       T01820                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00071  Fatty acid degradation
abz00072  Synthesis and degradation of ketone bodies
abz00280  Valine, leucine and isoleucine degradation
abz00310  Lysine degradation
abz00362  Benzoate degradation
abz00380  Tryptophan metabolism
abz00620  Pyruvate metabolism
abz00630  Glyoxylate and dicarboxylate metabolism
abz00640  Propanoate metabolism
abz00650  Butanoate metabolism
abz00900  Terpenoid backbone biosynthesis
abz01100  Metabolic pathways
abz01110  Biosynthesis of secondary metabolites
abz01120  Microbial metabolism in diverse environments
abz01130  Biosynthesis of antibiotics
abz01200  Carbon metabolism
abz01212  Fatty acid metabolism
abz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABZJ_01552
   00630 Glyoxylate and dicarboxylate metabolism
    ABZJ_01552
   00640 Propanoate metabolism
    ABZJ_01552
   00650 Butanoate metabolism
    ABZJ_01552
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABZJ_01552
   00072 Synthesis and degradation of ketone bodies
    ABZJ_01552
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABZJ_01552
   00310 Lysine degradation
    ABZJ_01552
   00380 Tryptophan metabolism
    ABZJ_01552
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABZJ_01552
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABZJ_01552
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABZJ_01552
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abz04147]
    ABZJ_01552
Enzymes [BR:abz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABZJ_01552
Exosome [BR:abz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABZJ_01552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AEP06012
UniProt: G2JIU6
Position
complement(1607274..1608479)
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFADEITPIEVFQGKKLPPKFVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatttatgatggtttacgtagtccatttggccgtcatgcaggtgaa
cttgcctcaattcgtcctgatgatttggccgcaactgtcattcaaaaactactagaaaaa
actggtgtaccgggcgctgatattgaagatgtgattttaggcgacactaaccaagcgggt
gaagatagccgtaatgtggcacgaaatgcattattacttgcaggtttacctgttactgta
ccgggccagacggtaaaccgcctatgtgctagtggtttaggtgccgtgattgactcagca
cgtgctattacttgtggtgaaggtgaactgtatattgctggtggtgtagaaagtatgtca
cgtgcaccctttgtgatgggtaaagcagaaagcgcttatagccgtgatgcaaaaatttat
gacaccaccattggctctcgctttccaaataaaaaaattattgctcagtacggcggacat
tcaatgcctgaaacgggcgataacgttgcagccgagtttgggattagtcgtgagcaagca
gacttatttgcagcccaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gccgatgaaattactccaattgaggttttccaaggcaaaaaattgccccctaaattcgtt
tcagaagatgaacatcctcgcccaagttcaactgttgaagcactcacaaagttaaaaccg
ctatttgaaggtggcgtggttacagctggtaatgcctcaggtattaatgatggtgcagca
gcacttttgattggttcagaagcagcaggtcaaaaatatggcttaaaaccaatggcaaaa
atcttatcagcggcggctgcaggtattgagccacgcattatgggtgcaggtccgatcgaa
gccattaaaaaagcggttgcacgtgctggccttactttagatgacatggatattattgaa
attaatgaagcctttgcttcacaagttttatcttgtttaaaaggtttaaatgttgatttt
aatgatccacgtgtgaacccgaacggtggtgcgattgctgttggtcatccacttggtgct
tcaggcgctcgtcttgcgttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcttatgtattggtgtaggtcaaggtcttgcgatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system