KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01902Help
Entry
ABZJ_01902        CDS       T01820                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00010  Glycolysis / Gluconeogenesis
abz00020  Citrate cycle (TCA cycle)
abz00620  Pyruvate metabolism
abz01100  Metabolic pathways
abz01110  Biosynthesis of secondary metabolites
abz01120  Microbial metabolism in diverse environments
abz01130  Biosynthesis of antibiotics
abz01200  Carbon metabolism
Module
abz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABZJ_01902
   00020 Citrate cycle (TCA cycle)
    ABZJ_01902
   00620 Pyruvate metabolism
    ABZJ_01902
Enzymes [BR:abz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABZJ_01902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEP06362
UniProt: G2JJ53
Position
1964840..1966375
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRK
ILAKDGDTLPVGGLIAVCADNEVSDAEIEKFIASLGGSAAQAPAAPSEQSKAETSVPVAE
KAEQPLTTAASASAPAKVAKGDYAVPESLQGYQTSDDLFATPHALKLAEKHNVNLAKVTG
SGREGRISVQDIQKTVQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGIN
LNDCRVSGTRGRVCKEDVEAVYYRNNPVSVSEQPLQCATQPQSTVTTVAMNGMRKAIASR
LQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNV
QFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQ
PDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATL
SCDHRVIDGAVGAKFLASFKQFVENPALILV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattaaaacgctggagatcccaaaatggggattatccatggaagaaggcacg
atcgcccaatggttgattaaagagggtgatagctttaataagggcgatgaaatttgtgaa
attgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgctggaacgctccgtaaa
attttagcgaaagatggtgatactttacctgttggtggacttattgccgtatgtgctgat
aatgaagtttctgatgcagaaattgaaaagtttatcgcatcactaggtggttcagcagct
caagcacctgcagcaccttcggaacaaagtaaagcggaaacatctgtacctgttgctgaa
aaagcagaacagccactgactacagcagctagtgcttcagctcctgcaaaggtagctaaa
ggggactacgctgtaccagagtcattacaaggctatcaaacatctgatgatttgtttgca
acaccacatgcgttaaagcttgcagaaaagcacaatgtaaacttggcaaaagtcacaggt
tctggtcgtgaaggacgtattagtgttcaagacatccagaagactgtacaggctgctggt
ggtcagtggcctgatgttaagcagcaaactcaaactaaagtggttaaatctacagctgat
gatagccaaattttagcgacgcctgtagcacgccgtttagcaaaacaatggggcattaac
ctaaatgactgccgtgtttcaggtactcgtggccgtgtctgtaaagaagatgttgaggca
gtttactatcgtaataacccagtgtcggtaagtgaacaacctttgcaatgtgcaactcaa
ccacaatcaaccgttacgacggtggcgatgaatgggatgcgtaaagcgattgcttcacgg
ttacaggctgcaaaacgtaacgcaccgcatttccgcttagtggtcgatctcaacgtagaa
gctttgcaaaaactacgtaagcagattaatgagactgttccacaagtgaaactttctatt
aatgacatgctaattaaggcagcggcggcggcactgattaaagtacctgaagtgaatgtt
caatttgatgaggcgactcaatcaattttacagttctctcaagcggatatttcggtggcc
gtagcgattccaaacggtttaattacacccattgtaaaagcagcaaatcaaaaatcgttg
gcacaaatttccgatgacatgcgtgatttggcaactcgtgctaagactggcaagttacaa
cctgacgagtttcagggtggtagctttagcatttcaaatttaggaatgttaggcattaaa
cagttcgatgccattattaacccaccgcaaggtgcaattatggcattaggtgcttcggaa
tctcgtgctgttgttgaaaatggcaatgtagtggttcgtgagattgtcacagcgacgttg
tcatgcgatcaccgagttattgatggcgcagttggggcgaaattcttggccagctttaag
cagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system