KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01936Help
Entry
ABZJ_01936        CDS       T01820                                 

Definition
(GenBank) CoA transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00072  Synthesis and degradation of ketone bodies
abz00280  Valine, leucine and isoleucine degradation
abz00650  Butanoate metabolism
abz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABZJ_01936
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ABZJ_01936
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABZJ_01936
Enzymes [BR:abz01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     ABZJ_01936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AEP06396
Position
complement(3247357..3247998)
Genome map
AA seq 213 aa AA seqDB search
MAWSRNEMAQRAAKELEDGFYVNLGIGLPTLVANYIPENINVWLQSENGLLGIGEFPTEE
TVDADLINAGKQTVTARSGAAFFSSSESFAMIRGGHVNIAILGAMEVSEKGDLANWMIPG
KKVKGMGGAMDLVVGVQKVVVLMEHCAKDGTPKIVKNCSLPLTGKGVVHRVITDLGVMDI
TPQGVELIELAKDVTLEQIQAATGVEFYKTLVA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttggtcacgtaatgaaatggcacaacgtgctgcaaaagaactcgaagatggtttt
tatgtcaatttaggtattggcttacctacccttgttgccaattatattcctgaaaatatt
aatgtttggcttcaatctgaaaatggcttattaggtattggtgaattcccgactgaagaa
actgtggatgccgatttaattaatgctgggaaacaaacggttactgctcgctctggtgca
gcctttttctcaagctcagaatcttttgccatgattcgtggtggccatgtcaacattgca
attttaggtgcaatggaagtttctgaaaaaggagacttagcgaactggatgattccgggt
aaaaaagtcaaaggtatgggcggtgcaatggacttggttgttggtgttcaaaaagttgtt
gttcttatggaacactgcgcaaaagacggtacaccaaaaatcgtgaaaaactgtagtttg
cctttaacaggtaaaggtgttgttcatcgcgtaattacagacttaggcgtaatggatatt
acgccacaaggtgtagagctcattgaacttgctaaagacgtaacgctcgaacaaattcaa
gctgctacaggtgtcgagttttataaaaccttagtcgcgtaa

DBGET integrated database retrieval system