KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03139Help
Entry
ABZJ_03139        CDS       T01820                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00020  Citrate cycle (TCA cycle)
abz00190  Oxidative phosphorylation
abz00650  Butanoate metabolism
abz01100  Metabolic pathways
abz01110  Biosynthesis of secondary metabolites
abz01120  Microbial metabolism in diverse environments
abz01130  Biosynthesis of antibiotics
abz01200  Carbon metabolism
Module
abz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABZJ_03139
   00650 Butanoate metabolism
    ABZJ_03139
  Energy metabolism
   00190 Oxidative phosphorylation
    ABZJ_03139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF2614
Motif
Other DBs
NCBI-ProteinID: AEP07599
UniProt: G2JKD5
Position
complement(3231461..3231841)
Genome map
AA seq 126 aa AA seqDB search
MDYVLMKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLP
MKIFSLLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGI
QIFWAN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggattatgttctaatgaaaagtgctacaggtttaacaggttcaggttctcgtgattgg
tttatccagcgtgtaagtgctgtggtattggcagcttatactgttgttctttttggttgg
atcctctgcaaaggcggatttgactatcaacaatgggctggcttcatgatgacattacca
atgaagattttctctttattggcaattttgtcgcttatcgcacacgcatggattggtatg
tggcaggtttttactgactatgtcactactcgtcaaatgggtccttcagcgaaaggttta
cgccttgtactgactacggctgtcattattgcagtgtttgtgtacgcaatctggggtatc
cagattttctgggcgaattga

DBGET integrated database retrieval system