KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03193Help
Entry
ABZJ_03193        CDS       T01820                                 

Definition
(GenBank) polyprenyl synthetase family protein
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00900  Terpenoid backbone biosynthesis
abz01100  Metabolic pathways
abz01110  Biosynthesis of secondary metabolites
abz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABZJ_03193
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:abz01006]
    ABZJ_03193
Enzymes [BR:abz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     ABZJ_03193
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     ABZJ_03193
Prenyltransferases [BR:abz01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ABZJ_03193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AEP07653
Position
complement(527919..528830)
Genome map
AA seq 303 aa AA seqDB search
MSSLSQVNADVLKQAQQRIQQDLLTTLAAFSIPEPLKSAVHHAVMLGGKRVRPALCYATA
SLQDNPNFAAARRAAVAVELIHCYSLAHDDLPCMDNDLLRRGQPTCHVAFGEDTALLAGD
ILQSMAFEVLGSRLFDEQGQGTDAAIVLKQIQILATASSKMVCGQVLDLQAEAKQISQDE
LENIHRNKTGALIQAAIMMGAVTIFSGTDQAIPKLRQYGQAIGLAFQVQDDILDITSSTE
TLGKTAGKDEQVQKSTYPALMGLEQAQIYAKELHDQAFDALAHFGENAKELVEISQFLLA
RTN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcactctctcaagttaatgcggatgttttaaaacaagctcaacaacgtattcaa
caagatttattgacgacactggctgcattctcaattcccgaacctttaaaaagcgctgta
caccatgcagttatgctcggtggaaaacgtgtgcgtccggctttgtgttacgctacagct
tctttacaagataatccaaattttgcggctgctcgccgtgctgcggttgctgttgaactc
atccattgttattccttagcacatgatgacctgccttgtatggacaatgatttgcttcgc
cgtggtcagccaacgtgtcatgttgcatttggtgaagataccgcgttacttgcgggtgac
attttacaatcaatggcttttgaagttttagggagccgtttgtttgatgagcaagggcag
ggaacggatgctgcaattgtcttaaagcaaattcaaattttagctacagctagttctaaa
atggtttgtggacaggttttagacttacaagcggaagctaaacaaatttctcaagacgaa
ctagagaatattcaccgtaataaaacgggtgcgcttattcaggctgctattatgatgggg
gcagtgacaattttctcgggtacagatcaggcaattccaaaactacgtcaatatggtcaa
gcaattggactggcttttcaggtccaagatgatattttggatattacgtcgagcactgaa
actttaggcaaaaccgctggtaaagatgaacaagtacaaaaatcgacttatcctgctcta
atgggactagagcaagcacagatttatgccaaagaattgcatgatcaagctttcgatgcc
ttagcgcatttcggtgaaaatgcaaaagaattagttgagatttcacaattcctgttagct
cgtactaattaa

DBGET integrated database retrieval system