KEGG   Acidobacterium capsulatum: ACP_0024Help
Entry
ACP_0024          CDS       T00868                                 

Definition
(GenBank) glycosyl hydrolase family, 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00052  Galactose metabolism
aca00500  Starch and sucrose metabolism
aca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ACP_0024
   00500 Starch and sucrose metabolism
    ACP_0024
Enzymes [BR:aca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ACP_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 DUF4975
Motif
Other DBs
NCBI-ProteinID: ACO33008
UniProt: C1F7Y1
Position
30784..32343
Genome map
AA seq 519 aa AA seqDB search
MNRRELFRTAAGLAGAIALGQADWAINRPRNTAIADLEARLALDPRRPQFHLLPQRNWMN
DPNGPIYWKGQYHMFFQYNPDAAVWGDMHWAHAVSPDMVHWRHLPIALAPTPGGPDAAGC
FSGTAVVDNGVVTVLYTGVVNSTLANATLNDGQHIFRESQCLATSIDPDLKTWKKLAAPV
IAAPPPGLSITGFRDPSPWRSGEWWYLAVGSGNAHTGGDVLLYRSRDLRHWQYLHKLVSG
EQSAKGAINPVANGDMWECPDFFPLGEKHVLIYSSRGGVHWQTGTLDKEAMRFHPEKTGI
LDYGAFYAAKTQLDQQGNRILWGWIPEQRPAAEYSAAGWAGMMSLPRVLRMQPDGGLGVA
FSPAVHSLRTREHRLDPSQKIQSQLAGLFLPRATGEILAQLNCDHRAFSFSLIAKFPHKQ
QSQPIVEIAYDPSSRQIFADKKAVPIAWDRDNLLQLHIYVDGSVAEILLSGKAVYTKRFY
YAGEDAPGIYVHLQAAGQILNSFRLWHLKAISPNRLTTG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccgcgaattgttcagaaccgctgcaggtcttgcgggtgcgatcgctctgggg
caagccgactgggccatcaacaggccacgcaacaccgccatcgcagatctcgaggcgaga
ctggctcttgacccgaggcgcccgcaattccatctcttgccccagcgcaattggatgaac
gatcctaacggccccatctactggaaaggccagtaccatatgttcttccagtacaaccct
gacgccgcggtgtggggagatatgcattgggctcacgccgtcagccccgatatggttcac
tggcggcatcttccgatagcccttgcgcctactccaggcggtcccgacgcggctggctgc
ttctcgggcacagcggtggtcgataacggagtggtcacggttttatacaccggcgtagtc
aacagcactctggctaatgccacactcaatgatggccagcacatattccgcgagagtcag
tgtcttgcaacttcaattgacccggacctcaaaacatggaaaaagcttgctgcgcctgtg
atcgccgctccacctcccggcctgtcgattaccggctttcgcgacccgtcgccgtggcgc
agcggagagtggtggtatctcgccgtaggttcaggcaatgcgcacaccggcggggacgtg
ttgctttatcgctcgcgcgacctcagacattggcaatatctgcataagctggtgagcggc
gagcagtccgcgaaaggcgcaatcaatcctgttgccaacggtgacatgtgggagtgtccc
gacttctttccgctcggggagaagcacgtgctgatctactcctctcgcggaggcgtgcat
tggcagacgggcacgttagataaggaagcaatgcgcttccaccccgagaagaccggcatt
ctcgactacggcgccttttatgccgccaagacgcaattggatcaacaggggaaccgcatc
ctctggggatggattccagagcagcgtcccgctgctgagtacagtgcggcgggctgggct
ggcatgatgtctctgcctcgcgtgttgcgcatgcagccggatggcggcctcggcgtcgcc
ttcagcccagccgtgcacagcctccgcacgcgcgaacatcgcctcgatccttctcaaaag
atacaatcgcaactcgcggggctctttctcccacgtgcaaccggggaaatcttggctcaa
ctgaattgcgatcatcgagcctttagcttctcactgattgcaaagtttccgcacaagcag
cagtcccagcccattgtggaaattgcctatgatccgtcgtcgcggcaaatctttgcagac
aagaaagcagtgcccatcgcatgggaccgcgacaatcttttgcagttgcacatttatgtc
gatggttccgtggcagagattctcttgtctggtaaagcggtatacaccaagcgcttctac
tatgccggtgaagatgcgccgggcatttatgtacacctgcaagctgcagggcaaattctc
aatagcttccggctttggcatctcaaggcaatttcgccgaacaggctaactactggataa

DBGET integrated database retrieval system