KEGG   Acidobacterium capsulatum: ACP_0153Help
Entry
ACP_0153          CDS       T00868                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00520  Amino sugar and nucleotide sugar metabolism
aca00550  Peptidoglycan biosynthesis
aca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACP_0153 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACP_0153 (murA)
Enzymes [BR:aca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     ACP_0153 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:aca01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   ACP_0153 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACO33518
UniProt: C1F8M5
Position
complement(195082..196392)
Genome map
AA seq 436 aa AA seqDB search
MDKFVIRGGNPLIGTVRVSGAKNSALPCMAAAILTEDEVILENIPQVRDIETERKLLTSM
GAEVELGYGRAQHRTTISCRVLSDPTAKYEIVKTMRASALVLGPLVARTGLARVSMPGGC
AIGARPIDLHIKGLEQMGATIVYEHGYIEARAERLKGAQIHFDKITVTGTEDLMMAAVLA
EGETVLENAAREPEVTDLAALLTAMGAQIEGAGTSEIRIQGVEKLHGARHRINPDRIEAG
TFLIAGAITGGDLCVSHCNPAHLGAVIAKLEEAGVRIDVLGKDSLRVRSEGHLKPIDVST
EEYPGFPTDMQAQYMALATQAEGTTLVKENIFENRFMHVQELVRMGANIKTAGRIASVRG
KTPLSAAAVMCSDLRASASLVLAALVANGESILDRVYNIDRGYEHIEEKLRGVGAQIKRL
GNVFNDKREAAQISAS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatttgtaattcgcggcggcaatccactcatcggcacggtccgggtgagcggc
gcaaaaaactcggcgcttccctgcatggcggcggccatcctcactgaagatgaggtcatt
ctcgaaaacattccgcaggtgcgcgacattgagaccgagcgcaagctgctcacctcgatg
ggcgcggaagtagagctgggttatggccgcgcgcagcatcgcacgaccatcagttgccgc
gtgctttctgatcccaccgcgaaatacgagatcgtcaagacgatgcgcgcgagcgcgctg
gtgctgggcccgctcgtggctcgcaccggtctggcgcgcgtctccatgcccggtggatgc
gccatcggagcccgccccatcgatctgcacatcaagggcctggagcagatgggcgccacc
atcgtctatgagcacggctacattgaagcccgcgccgaacgcctgaagggcgcacagatt
cacttcgataagatcaccgtcaccggcaccgaagacctgatgatggccgccgtgctggcc
gagggcgaaaccgttctggaaaacgccgcccgcgagcctgaggtcaccgatctcgccgcg
ctgctcaccgccatgggcgcgcagattgagggcgccggcacttcagagattcgcattcag
ggcgtcgagaagctccacggcgcgcggcatcgcatcaatcccgaccgcattgaggccggc
acctttctcatcgccggagcgatcaccggcggcgacctctgtgtgagccactgcaacccg
gcacacctcggagccgtcatcgccaagctcgaagaagcgggcgtccgcatcgatgtgctc
ggcaaggactccctgcgcgtgcgcagcgagggccatctgaagccgatcgatgtctccact
gaagaatatcccggctttcccactgacatgcaggcgcagtacatggcgctcgccacgcag
gccgaaggcaccacgctcgtcaaggagaacatcttcgagaatcgcttcatgcacgtgcag
gaactcgtgcgcatgggcgcgaacatcaagaccgctggccgcatcgcctccgtacgcggc
aaaacgccgctctcggctgctgccgtcatgtgctctgacctgcgcgcctcggcctcgctg
gtgctcgccgcgctcgtcgctaatggtgaatccattctggaccgcgtctacaacatcgat
cgtggctacgagcacattgaagaaaagctgcgcggagtcggcgcgcagatcaagcgcctc
ggcaacgtcttcaatgacaagcgcgaggcagcacagatcagcgcctcgtag

DBGET integrated database retrieval system