KEGG   Acidobacterium capsulatum: ACP_0671Help
Entry
ACP_0671          CDS       T00868                                 

Gene name
nadE
Definition
(GenBank) NAD+ synthetase
  KO
K01950  NAD+ synthase (glutamine-hydrolysing) [EC:6.3.5.1]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00760  Nicotinate and nicotinamide metabolism
aca01100  Metabolic pathways
Module
aca_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:aca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ACP_0671 (nadE)
Enzymes [BR:aca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.1  NAD+ synthase (glutamine-hydrolysing)
     ACP_0671 (nadE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_synthase CN_hydrolase Asn_synthase PhoPQ_related tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ACO33521
UniProt: C1F1R3
Position
complement(759836..761494)
Genome map
AA seq 552 aa AA seqDB search
MKIALAQINPTVGDFHGNVQKILDFTRRAADAGAHLAIFPELAVCGYPPADLLEKPSFVA
RCEEAIAHIAHETASLRIAVLCGYVTPAPHGSGKHVMNSAALLSEGHVEFVQSKMLLPFY
DVFDEQRYFAPARHQQICHFHGQSIAITICEDAWNDKSFWEHRRYSVDPIEELTRHGASV
ILNLSASPYWRGKRTTRQHMLANIARQHNLPVVMVNQVGGNDSLVFDGTSIALAPDGRVC
AQARSFEEDLVLFDTETLQGDLHAVTGPSEDDKTAALLDALTLGTRDYVRKCGFSRVVVG
LSGGIDSALVAAIAVRALGAENVHGYGMPSAFSSQGSIDDSRQLAAHLGIGFDVLPIHGL
YEKYLETLAPVFAGLKPDVTEENIQSRIRGALLMAVSNKRNALVLTTGNKSEMSTGYCTL
YGDMVGALAVIGDVVKTQVYALCRYLNREQEIIPHAILDKPPSAELRPDQKDTDTLLPYD
QLDPIVEAYVERYESAERIAASQNIDLATVRTVIRMIERAEYKRQQAAPVLKVTPKAFGL
GRRFPIAVKVEV
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtgaagattgccctcgcacagatcaatcccaccgtgggagacttccacggaaacgtacag
aaaatcctcgacttcacgcgccgcgccgccgatgccggcgctcatctggccatctttccc
gagcttgccgtttgcggctacccgccggccgatctgctcgaaaaaccatccttcgtcgcc
cgctgtgaagaggccatcgcccacatcgcgcacgaaacagcgtctctccgcatcgcggtt
ctctgcggctacgtcacgcccgcgccccacggcagcggcaagcatgtcatgaactccgcc
gccctgcttagcgagggccatgtcgagtttgtccagtccaaaatgctgctgccgttctat
gacgtctttgatgagcagcgctacttcgcgcccgcgcgccaccagcagatttgccacttc
cacggccagtccatcgccatcaccatctgcgaagacgcttggaacgacaaaagcttctgg
gagcaccgccgctactccgtcgatcccatcgaagagctcacccgccacggcgcatccgtg
attctcaatctctcggcctcgccctactggcgcggcaagcgcaccacgcgccagcacatg
ctggccaacattgcccgccagcacaatcttcccgtcgtcatggtcaatcaggtcggcggc
aatgacagcctcgtctttgacggaaccagcattgctctcgcgcccgatggccgcgtctgc
gcacaggctcgctcctttgaagaagacctcgtcctcttcgacaccgagaccctccagggc
gacctccacgccgtcaccggcccgtcagaagacgacaagaccgccgccctgcttgacgcg
ctcacgctcggcacccgcgactacgtgcgcaaatgcggattctcccgcgtcgtcgtcggc
ctcagcggcggcattgactccgcgctcgtcgccgccatcgccgtccgtgccctcggcgcg
gaaaacgtccacggctacggcatgcccagtgccttctcttcgcaaggctccattgatgac
agccgccagctcgccgctcatctcggcatcggctttgacgtgctgcccatccacggcctc
tatgagaaatacctcgaaaccctcgcccccgtcttcgccggcctcaagcctgacgtgacc
gaggagaacatccagtcccgcatccgcggcgcgctcctcatggccgtctccaacaagcgc
aacgcgctcgtgctcaccaccggcaacaagagcgaaatgtccaccggctactgcaccctt
tacggcgacatggtcggcgcgctcgccgtcatcggcgacgtcgtcaaaacgcaggtctac
gccctctgccgctacctcaatcgcgagcaggagatcattccgcacgccattctcgacaag
ccgccctcggccgaactccgccccgatcaaaaagacaccgacaccctcttgccctacgac
cagctcgatcccatcgtcgaggcctacgtcgagcgctacgagagcgccgagcgcatcgcc
gcctcgcagaacatcgatctggccaccgtccgcaccgtcattcgcatgatcgagcgcgct
gaatacaaacgtcagcaggccgcgcccgtccttaaagtaacccccaaagcatttggcctt
ggccgccgcttcccgatcgccgtcaaggttgaggtgtaa

DBGET integrated database retrieval system