KEGG   Acidobacterium capsulatum: ACP_0818Help
Entry
ACP_0818          CDS       T00868                                 

Definition
(GenBank) NAD dependent epimerase/dehydratase family protein
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
aca  Acidobacterium capsulatum
Brite
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     ACP_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 NAD_binding_4 NmrA GDP_Man_Dehyd Polysacc_synt_2 RmlD_sub_bind KR adh_short Sacchrp_dh_NADP Ldh_1_N DFP
Motif
Other DBs
NCBI-ProteinID: ACO32382
UniProt: C1F2R9
Position
complement(936551..937552)
Genome map
AA seq 333 aa AA seqDB search
MKVLVTGATGFVGSHVAKELAAQGASLRLLVRKTSNLANLEGLNAETVTGDLMEPESLRT
AVRGCEALLHVAADYRLWVRDPKQMYAANVEGTRALLQMAREEGVGRCVYTSSVATMAFR
EDGTIVDEATPVSVDDMVGHYKRSKFLAEQVALEAAAAGQAVIVLNPTTPIGPGDIKPTP
TGRIVVDFLNRKFPAYMDTGLNLVDVKEVARTHVAALDPAVGRPGERYILGGENLTLKQI
LDKMSAITGLPSPTMKVSHGVAMAFAFFDETIQGKLLGREPRATVESVRMGRKKMFASSA
KAQRELGFRVVPVYEALREAIAWFRAHGYAPLA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtgctggtgaccggcgcgacgggcttcgtcggcagccatgtggcaaaagaactg
gcggcgcagggagccagcctgcgcctgctggtgcgcaagacgagcaacctggccaatctg
gaagggctgaatgccgaaacggtgaccggcgacctcatggagccggagtcactgcggacg
gcggtgcgcggctgcgaggcgctgctgcatgtggcggcggattaccggctgtgggtacgc
gaccccaaacagatgtatgcggccaatgtggagggcacgcgcgcgctgttgcagatggcg
cgcgaagagggtgtggggcgctgcgtctatacgtcgagcgtggccacgatggcctttcgc
gaagatggcaccattgtggacgaggccacgccggtgagcgtggacgacatggtggggcac
tacaagcggtcgaagtttctggccgagcaggttgcgctggaggcggccgcggcggggcag
gcggtgatcgtgctgaatcccacgacgccgattggcccgggcgacatcaagccgacgccc
acagggcgcattgtggtggattttctgaaccggaaattcccggcctacatggacacgggg
ctgaacctggtggacgtcaaggaagtggcgcggacgcatgtggcggcgcttgatccggca
gtgggcaggccgggcgagcggtacatcctgggcggcgaaaacctgacgctcaagcagatt
ctggacaagatgtcggccatcaccgggctgccgtctccaacgatgaaggtttcgcacggc
gtggcgatggcctttgcgttctttgacgagaccattcagggcaagctgctgggccgggag
ccgcgcgcgacggtcgagtcggtacggatggggcggaagaagatgtttgcctcctcggcc
aaggcgcagcgggagctgggctttcgggtggtgccggtgtatgaggcgctgcgcgaggcg
attgcgtggttccgggcgcatgggtatgcgccgctggcgtaa

DBGET integrated database retrieval system