KEGG   Acidobacterium capsulatum: ACP_1184
Entry
ACP_1184          CDS       T00868                                 
Name
(GenBank) type IV secretion/conjugal transfer ATPase, VirB4 family
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
aca  Acidobacterium capsulatum
Pathway
aca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACP_1184
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aca02044]
    ACP_1184
Enzymes [BR:aca01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ACP_1184
Secretion system [BR:aca02044]
 Type IV secretion system
  Trb secretion system protein
   ACP_1184
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB DUF87 TrwB_AAD_bind AAA_10 FtsK_SpoIIIE AAA_7 AAA_22 ABC_tran
Other DBs
NCBI-ProteinID: ACO33714
UniProt: C1F4R3
Position
1393231..1395735
AA seq 834 aa
MLRFDKIIKPWRDAAAFGDYLNLYGFWNETAFLTKSGDPGMVLRVTGVDYESLDYGEQEY
AVKRLEAALKNFGPGFHVYQYLFKTNKPEIPFAEYDDAIVQAGQERRREHFLKKADHLFE
IEIYYAILLEGARSKTGFSTAFERLSHDPAGGLDELKAQFSNRSMKVLLRSQIERDLAWL
EQRVQTFVRQLADFARIEVLDYKGQFRFFRRLVNYDDWRIAGEPGHSQFLCDQVVNSLLE
PERDHLRVGDDYVRILTMKEAIGETRPLALDALLKIPANFMAISEWMPLPAEAARKEVNK
RRRHFNISKTGFVSQLSNDPAKTNPRDVLVDESKQADIENLGDCLRALGDGRQLGEFSLT
IVLYGKDRQAVDSLVGEFASVFTNADGTLFAETYNQLNAYFAIVPGNYAFNLRRLYLLNT
NYADLSFLFTILPGEKVNSYLGAEYLAVMETDNQTPYFLNLHCGEVAHTLILGMTGSGKS
YLCSFLLQNAQKYNPFTFIFDIGGGFEALTHIFGGSYLNVGREERDFTINPFSLAPTREN
QQFLFSLLRVLIEGDNQRYKLDFREEIKLWNGIERIYMLEPGQRTLSNLSSIVGELKDRL
YRWTRAGQYGFLFDNPNDTLSFTNFQTFNFRGWGDAPELLEPLLFYILHRASQEICDPRR
LATFKTFLMDEAWLFMRNQVIRDYIMQAQKMWRKHNAAMILATQSIKELQESGMLHIVAE
SCPTKIFLANPEMDRAVYAEAFHLNNTELDLIASLVPPGQMLIRKAQSSKKVHLNVDSVT
HWMAVNSANENLLRREYFTRYGISEGLRRLADEHPFESHQQTHTSKPNSKGAAA
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgctgcgcttcgacaagatcatcaagccgtggagggatgccgccgccttcggcgactac
ttgaacctgtatggcttctggaacgaaacagcgtttctgaccaagagcggcgatcctggc
atggtgctgagggtcacgggcgtcgattacgagagcctcgactacggcgagcaggaatac
gcggtgaagcgcctcgaagctgcgctcaagaacttcgggccaggattccacgtctaccaa
tatctattcaagacgaacaagccggaaattccgttcgcggagtacgacgacgccatcgtg
caggcgggccaggagcgccgtcgcgagcatttcctgaagaaagcagatcatctattcgag
atcgagatttattacgcgatcctgctggaaggcgcgcggtcgaaaaccggcttcagcacc
gctttcgagcgtctttcccatgatccggcgggtggcctggatgagctgaaggcgcagttc
tcgaaccgcagcatgaaggttctgctgcggtcgcagattgagcgcgatctggcctggctt
gagcagcgcgtacagacgttcgtccgccagcttgccgacttcgcgcggatagaagtgctc
gattacaagggccagttccgattcttcaggcggctggttaactacgacgactggcgaatt
gcaggagagccgggacactctcagttcctctgcgatcaagtcgtgaactcgctgctcgaa
ccggaacgcgaccacctccgcgtcggcgacgactacgtccgcatcctgaccatgaaggag
gccatcggcgaaacacggcctctggcgcttgatgcgctgctgaagattcccgccaacttc
atggcgatctccgaatggatgccactgcctgcggaagcggcgcgcaaagaagtgaacaag
cgccgcaggcacttcaatatctcgaagaccggtttcgtctcgcagctcagcaacgaccca
gcgaagacaaacccgcgcgatgtgctggtggacgaatcgaagcaggcggacattgagaac
ctgggtgactgtctacgcgcgctcggcgacggacggcagctcggcgaattttcgctgacc
atcgtgctctacggcaaagaccggcaggcagtcgattcacttgtgggcgagttcgcgagc
gttttcaccaatgccgacggaacgctctttgccgaaacgtataaccagctcaacgcctac
tttgccatcgtacccggcaattatgctttcaatctccgccggctgtatttgctgaacacc
aattatgccgatctgagtttcctgttcacgatcctgcctggcgaaaaggtgaattcatat
ctgggtgccgaatacctcgctgtcatggagaccgacaatcagacgccttactttctgaat
ctgcactgcggggaggtggcccacaccctcattcttggtatgacgggcagtgggaaatca
tatttgtgctcgtttctgctccagaacgcacaaaagtacaatccgttcacattcatcttc
gatatcggcggaggatttgaggctctgacccacatcttcggcggcagctatctgaatgtt
gggcgcgaggagcgcgatttcaccatcaatccattttcactggctccgacccgagagaat
caacagtttctcttcagcctgttgcgcgtgcttattgaaggggataaccagcgatacaag
ctggattttagggaagagatcaagctctggaacggcattgagcgaatctacatgctggag
ccgggccagcggaccctttccaacctctccagcattgtcggagaactgaaagaccggctc
taccggtggacccgggcagggcagtatggattcctcttcgacaatccaaacgacaccctt
tcctttacgaacttccagacgttcaactttcgtggatggggcgatgcgccggaactgctg
gagccgctgctgttttacatcttgcaccgagcctctcaggaaatctgcgatccacggcgg
ctcgccaccttcaagacctttctcatggacgaggcgtggctcttcatgcgcaaccaagtc
atccgcgactacattatgcaggcccagaagatgtggcggaagcacaatgccgcgatgatc
cttgccacgcagtcgatcaaggaattacaggaatcggggatgttgcacatcgtcgccgaa
agctgccccaccaaaatattcctggccaacccggagatggaccgcgcggtctacgctgag
gcattccatctgaataatacggaactcgacctgatcgcgagtctcgttccgcccggccaa
atgctgatccggaaagcgcagtccagcaagaaggtccaccttaatgtggattcggttacg
cattggatggctgtgaacagcgccaatgaaaacctgctgcggcgtgaatatttcacgcgt
tacggaatctctgaaggtttacggcgtcttgccgacgaacatccctttgagtcccaccaa
caaacccacacatccaaaccgaattccaaaggagccgctgcatga

DBGET integrated database retrieval system