KEGG   Acidobacterium capsulatum: ACP_1612Help
Entry
ACP_1612          CDS       T00868                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00900  Terpenoid backbone biosynthesis
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACP_1612 (dxr)
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ACP_1612 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Sacchrp_dh_NADP Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACO33529
UniProt: C1F758
Position
complement(1931051..1932247)
Genome map
AA seq 398 aa AA seqDB search
MSLKRIAILGSTGSIGQSTLSIIESFPERFAVASLAAGRNLEAAFEQACRWRPLAISLAT
EELAAQLAARLKAAGVTGIEVLHGTAGTVRVATLPEVDFVVSAIVGVAGLEATYAAVEAG
KPVGLANKEAMVAAGDLLNAAARAKNVPLLPIDSEHNAIHQCMRAGDLHEVKQIWLTASG
GPFRTLPLADFEHITVAQALKHPTWVMGRRITIDSATMLNKGLEIIEACRLFDLPPSAVK
VTVHPQSTVHSLVEYVDGSLLAQISVTDMRLPILYAMTWPERVASELTFDMTALSQLTFE
TPDFERFPCLRLAYEAAETGGAHTIALNAADEIAVEAFLEGVIPFPGIPRTIEQVLEATP
HRHPQSITEVLALDEQARETARKLLAPAFRDAATPSRV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaagcgcatcgccatcctgggctcgaccggttccatcgggcagagcaccctc
agcatcatcgagagttttcctgagcgatttgccgtggcctcgctggccgcggggcgcaac
ctggaggctgcgtttgagcaggcctgccgctggcgtcccttggcgatttcactcgccacc
gaagaactcgccgcccagctggccgcgcgcctcaaggctgccggagtcaccggcatcgag
gtgctgcacggcaccgccggaaccgtccgcgtggccacgctgcctgaggtggactttgta
gtttcggccatcgtgggcgtggctggtctcgaagcgacttacgccgccgtcgaggcgggc
aagcccgtcggcctggccaacaaagaggccatggtggccgccggagacctgctgaacgcc
gccgcccgcgccaaaaacgtgccgctgctgcccattgactccgagcacaacgcgattcac
cagtgcatgcgcgccggcgatctccacgaggtgaagcagatctggctcaccgcctcggga
gggcccttccggacgctgccgctggccgactttgagcacatcaccgtggcgcaggccctc
aagcatcccacgtgggtgatgggccgccgcatcacgattgactcggccaccatgctcaac
aaaggcctggagatcatcgaggcctgccgcctctttgacttgccgccctcggccgtcaag
gtgaccgtgcatccgcaatcgacggtgcattcgctggtggaatatgtggatggcagcctg
ctggcgcagatttccgtcaccgacatgcgcctgccgattctctatgccatgacctggccg
gagcgggtggcctcggagctgacctttgacatgaccgcgctcagccagctcacctttgag
acgccggacttcgagcgcttcccctgcctgcggctggcctacgaggcggcggaaaccggc
ggcgcgcacaccatcgcgctcaatgccgccgatgagattgccgtggaggcattcctcgaa
ggggtcatcccgtttccgggcatcccacgtacaatagagcaggtactggaggcgacgcct
catcggcatccgcagagcatcacagaagtgctcgcgctcgatgaacaggctcgcgagacc
gcgcgcaagttgctagccccggctttccgcgacgcggccacaccctcccgcgtctaa

DBGET integrated database retrieval system