KEGG   Acidobacterium capsulatum: ACP_1721Help
Entry
ACP_1721          CDS       T00868                                 

Gene name
punA
Definition
(GenBank) purine nucleoside phosphorylase I, inosine and guanosine-specific
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00230  Purine metabolism
aca00240  Pyrimidine metabolism
aca00760  Nicotinate and nicotinamide metabolism
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ACP_1721 (punA)
   00240 Pyrimidine metabolism
    ACP_1721 (punA)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ACP_1721 (punA)
Enzymes [BR:aca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     ACP_1721 (punA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ACO33239
UniProt: C1F7J2
Position
2049564..2050418
Genome map
AA seq 284 aa AA seqDB search
MSSLSIFSETIEATACIRKRSPLQPKVAVVLGSGLGAFAGSLTNSKCMRFSEAPHFPVSN
VQGHSGRIHIGQCGDTPVLVMQGRVHAYEGYKPSQVAFPVRVMKQLGIEQVIVTNAAGGI
REGLQPGELVLIEDHINLTGYNPLCGVNEERFGPRFFDMTNAYSPRLRKLAHSVAEQHGH
SLKEGVYIGVLGPSFETPAEIRAFRSMGADLVGMSTVQEVIAARHMGLEVLGISCVTNLA
AGLQNEELTHEEVLETGKRTEAQLTQLLQGVIPQMAGLGREDAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctgtcgattttctctgaaacgattgaagcaaccgcgtgtattcgcaagcgc
agtccgctgcaacccaaggtcgccgttgtgcttggttcggggctgggcgcttttgccggt
tcgctgacaaattcaaagtgcatgcgcttttctgaggcgccgcacttccctgtttcgaat
gtgcaagggcatagcgggcgcattcatattggccagtgcggggatacaccggtgctggtg
atgcagggccgcgtgcatgcgtatgagggctacaagccatcgcaggtagcttttccggtg
cgtgtgatgaagcagctcggcatcgagcaggtgattgtgaccaacgcggcgggcggcatt
cgcgaggggctgcagccgggcgagctggttctgattgaggatcacatcaatctgacgggc
tacaacccgctgtgcggcgtgaatgaggaacgcttcgggccgcgcttttttgacatgacc
aacgcgtactcgccgcgcctgcgcaagctggcgcactccgtggcggagcagcatggccac
tccctcaaagagggcgtctacattggggtactgggaccgagctttgagacgccggccgag
attcgcgcctttcgctcgatgggcgctgacctggtaggtatgtccacggtgcaggaagtg
atagccgcacggcacatgggcctggaggtgctggggatctcctgcgtgaccaatcttgcc
gcaggcctgcagaacgaggagctgacgcacgaagaggtgctggagaccggcaagcgcacc
gaggcgcagttgacgcaactgctgcagggcgtgattcctcagatggccggactcggccgg
gaagacgcagcgtga

DBGET integrated database retrieval system