KEGG   Acidobacterium capsulatum: ACP_1772Help
Entry
ACP_1772          CDS       T00868                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01130  Biosynthesis of antibiotics
aca01230  Biosynthesis of amino acids
Module
aca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACP_1772 (trpC)
Enzymes [BR:aca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ACP_1772 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh HTH_35
Motif
Other DBs
NCBI-ProteinID: ACO32643
UniProt: C1F7P0
Position
complement(2105581..2106453)
Genome map
AA seq 290 aa AA seqDB search
MRSAAGPRPLAILRRHRTSRSRIPLHLQRILERTRAELAVRRRETPLAALEARASQHMPR
GFADALRRRAQQGPAIIAELKKASPSKGLIREGFAPEWLARTLEANGAAVLSVLTDEPFF
QGSLRNLELASAATQLPCLRKDFIVDEYQIVEARAHRADAILLIVAALTDEELARFTKAA
HELDLDVLCEVHTAGELARARDLGCDAYGVNNRDLVSFHVSLDVSLQLAAELPQGAVHVA
ESGIHTAEDLQKLRAAGFHAFLIGESLMRQPDPGAALAALLQPQLQEDRA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaagcgcggcagggcctcgccctctggctatactgagaagacaccgaacttcgagg
agccgcattcctttgcatctgcaacgcattctggagcgcacccgggccgagctggcggtg
cgccggcgcgaaacacctctggccgcgctcgaagcgcgcgcaagccagcacatgccgcgc
ggctttgccgatgccttgcgccgccgggcccagcaggggccggccatcattgcggagctg
aagaaggcgtctccgtccaaagggctgattcgcgaaggcttcgcgcccgagtggctggcg
cgcacgctggaggcgaatggcgcggcggtgctctcggtgctgacggacgagccgttcttt
cagggcagcctgcgcaatctggaactggccagcgccgcaacccaactgccgtgcctgcgc
aaggacttcattgtggacgagtaccagattgtggaggcgcgggcgcaccgggccgacgcg
attctgttgattgtggccgcgctcaccgatgaagagctggcgcgcttcaccaaggccgcg
cacgagctggatctcgacgtgctctgcgaggtgcataccgccggggaactggcgcgcgcc
cgcgatctgggctgcgatgcctatggcgtgaacaatcgcgacctggtgagctttcacgtg
agcctcgacgtctcactgcaactagcggcagagctgccgcagggcgcggtgcatgtggcc
gagagcggcattcataccgcggaggatttgcagaagctgcgcgcggcgggctttcacgcg
tttctgattggcgagtcgctgatgcgccagccggacccgggcgcggcgctggcagcgctg
ctgcagccccaattgcaagaggaccgcgcctga

DBGET integrated database retrieval system