KEGG   Acidobacterium capsulatum: ACP_2354Help
Entry
ACP_2354          CDS       T00868                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00020  Citrate cycle (TCA cycle)
aca00310  Lysine degradation
aca00380  Tryptophan metabolism
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01120  Microbial metabolism in diverse environments
aca01130  Biosynthesis of antibiotics
aca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACP_2354
  09105 Amino acid metabolism
   00310 Lysine degradation
    ACP_2354
   00380 Tryptophan metabolism
    ACP_2354
Enzymes [BR:aca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ACP_2354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ACO34121
UniProt: C1FAF5
Position
2732923..2734572
Genome map
AA seq 549 aa AA seqDB search
MPTDVVMPQMGESIFEGTITKWLKKPGESVQVDEPLFEISTDKVDAEIPSPVAGTVAEIK
VAEGTTVQINTVVAVINEGGSAAAAASASAPAAAPAPAAAPAPAAPASAPTPAASSSTGA
KHEVVMPQMGESIFEGTITKWLKQVGDKVEVDEPLFEISTDKVDAEIPSPVAGTLSEIKV
QAGNTVQINTVVAVIGGAAGTSAAPAAPAAPAPVAVAPAAAPSAPAAEEDYADSAEHVRS
SPLVRKIARENNVDLRKVSGTGAGGRITKDDIQGYLEGKPAAAPAAAAPAPVAAAPAPAA
APRATAPAPAAAVPQPGELVPMSKMRTIIAQRMIDSKHTSAHVHTVFKIDFTRIVKLREK
EKNKYEQRNGVKLTYMPFITRAVVATLRKMPIMHAQMKGDAILYPANINIGIAVALDWGL
IVPVIKQAEEKSFLGIARGIADLAERARGKKLKPDEVGSGTFTITNPGIFGEQFGTPIIN
QPESAILGVGGLFKEPAVITDKDGTDSIAIRHMIHLTLGFDHRIIDGADAGKFMAEVKKY
LENWTEDIG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgatgtagtcatgccccagatgggcgaatcgatctttgaaggcaccatcacc
aaatggctcaagaaaccgggcgagagcgtccaggtagacgagcccctcttcgagatttcc
accgacaaggtcgatgcggagattccttcgcctgtggcaggcacggtcgccgaaatcaag
gtcgccgaaggcaccaccgttcaaatcaacaccgtcgtcgccgtcatcaatgagggcggc
agtgcggcagcggccgcttcagcctcggctcccgcggcggccccagctcccgcagcggct
ccggcgccagcagccccggcttcggccccaactcctgcggccagttccagcacgggcgca
aagcatgaagtggtgatgccgcagatgggcgagtccatctttgagggcaccatcaccaag
tggctcaagcaggtgggcgacaaggtcgaagtggacgagcctctctttgagatctccacc
gacaaggtagacgctgagattccctcgcctgtggcgggcacactctctgaaatcaaggtg
caggccggcaacacggtgcagatcaacacggtggtcgccgtcattggcggcgcagccggt
acatccgctgctcccgctgctcctgccgccccggctccggtcgcagttgctccggcggcc
gcgccctccgctccggctgcggaagaggactacgccgacagcgctgagcacgtgcgctct
tcgccgctggtgcgcaagattgcccgcgaaaacaatgtggacctgcgcaaggtgtctggc
accggtgccggtggtcgcatcaccaaggacgatattcagggctacctcgaaggcaagccc
gccgctgctccggctgctgccgccccggcccccgtggccgctgcgcctgctccggctgcc
gcaccgcgcgctactgctcccgcgcctgccgctgccgttccgcagcctggtgagctggtc
cccatgtccaagatgcgcaccatcatcgcgcagcgcatgatcgactccaagcacaccagc
gcgcacgttcacacggtcttcaagatcgacttcacccgcatcgtcaagctgcgtgagaag
gaaaagaacaagtatgagcagcgcaacggcgtcaaactgacctacatgccgttcatcacg
cgcgccgtggtggccacgctgcgcaaaatgcccatcatgcacgcacagatgaagggcgac
gccatcctctacccggccaacatcaacatcggcatcgccgtggctctcgactgggggctg
attgtgccggtcatcaagcaggctgaggagaagagcttcctgggcattgcccgtggcatc
gcggacctcgccgagcgcgcgcgcggcaagaagctgaagccggacgaagtcggttcgggc
accttcacgatcaccaacccgggcatctttggcgagcagtttggcacgccgatcatcaat
cagcccgagagcgcgattctcggtgtgggcggcctcttcaaggagccggccgtcatcacc
gacaaggacggcacggactcgatcgccatccgccacatgattcacctcacgctcggcttt
gatcaccgcatcattgatggcgccgacgcgggcaagttcatggccgaggtcaagaagtac
ctcgaaaactggaccgaagacatcggctaa

DBGET integrated database retrieval system