KEGG   Acidobacterium capsulatum: ACP_3167
Entry
ACP_3167          CDS       T00868                                 
Name
(GenBank) type IV secretion/conjugal transfer ATPase, VirB4 family
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
aca  Acidobacterium capsulatum
Pathway
aca03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:aca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ACP_3167
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aca02044]
    ACP_3167
Enzymes [BR:aca01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ACP_3167
Secretion system [BR:aca02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ACP_3167
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_7
Other DBs
NCBI-ProteinID: ACO34606
UniProt: C1F578
Position
3662498..3664867
AA seq 789 aa
MTRAKTEQAKFVPWFAKAGAACSIVPIARFVNEHIFALKGGGYGCLFSLAGIDEEGLTDP
ELEARMRSLEGALHGLPEGSCLYQYTRLMSGFELPRRPHYQNPVTQVFADDRLTFLERTA
GFRRIDLHWCLTIEPPRIKAFQQKPKELAADTSRMLAELEKTATILEGHLGSSLGLRLLG
KDAAFQFFSYVFNLEEWAEDDQLRANTGVDRQIVKNPITWHSDHLRVGKRYVQMFSLKAT
PEASRPCLFSSLLTLDCDSIVCSTWRPKSTAAARSEIDAQEKFISFFKVGVLTRVMSGRD
TASLETGAGAKAANSSVDDLSEVIRSLDKKSQGEYSLRLLLAANSPEHLRDTIPAVHRAF
VDARTQMIEESLGNLSAFYAMFPGNGKFNVFPLWLSEDHHARLSSIFAPHLGHPHSEDLD
AEYLNVFETRTRTPFFQDVYVDGVRVMLILGPTGTGKSVHGNQLIALEQKYGGFSYIFDI
GGSYESVVELYGGRVDRIGKDGPRVNPFALEPTESNLKFLYTFIRLLLANGGAELEPEDD
DVIHKAVQDMYLLDRENRRLSNLYLPKKLDRYLSKWVRDGVYHAIFDNVEDGLSLSRVQC
FDFAGVNNEQYADLIEPLMVWLLRRINDVLHDPANLGVPKHILIEELFPSMKNRQLLEGA
LSSIKTVRKNLGGVTLIGQSAEDLGENADSIVNSCSSFLLLKDPTFNRKRYAELFRMNEQ
QLALFESLQDREALYIRRDGLTKVVILNLDSRSYATFSTKPKDRVRRSKLIAKYGLAEGI
DRFAQGEIA
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgacccgcgcaaagactgaacaagcaaaattcgtgccatggttcgcgaaggccggagcc
gcgtgcagcatcgttccgattgcacgcttcgtcaatgagcacatctttgcgctcaaaggc
ggcgggtacggatgcctgttctctttagccggtatcgatgaagaggggctgactgacccg
gaactcgaagcgcggatgcgttcgctggagggagcgctccatggcctgccagagggttca
tgcctctatcagtacacccgcttgatgtccggcttcgagctgccgcgccgaccgcattac
caaaatcctgtgacgcaagtattcgcggatgaccgactgacgtttcttgagagaaccgcg
ggattccgacgcatcgacctgcactggtgcctgaccatcgagccgccaaggatcaaggca
ttccagcagaagccgaaagagctcgccgccgacacttcgcggatgctcgccgaacttgag
aagacggccacgattctggaaggtcatcttggcagttcgttgggactgcggctgctcggc
aaggatgccgcattccaattcttcagttacgttttcaacctggaggaatgggcggaggat
gaccaactccgggccaataccggtgtagaccgccagattgtgaaaaacccgattacctgg
catagcgaccatctgcgggtgggcaagcgctacgttcagatgttttccctgaaggcgacg
ccggaggcatccaggccatgcctcttttccagcctactgacgctcgactgcgacagcatc
gtctgctcaacatggcggccaaagtccaccgcagcggctcgaagcgagatcgacgcccag
gagaagttcatttccttcttcaaggttggcgtgctgacgcgcgtcatgagcgggcgtgat
acggcatcgctcgaaaccggagccggggcaaaggccgccaatagcagtgtcgatgatctg
agcgaagtcatccgctcgctcgataaaaagtcccagggcgaatactcgctccgcctcttg
ctggctgcaaacagcccggagcacttgcgcgataccatccccgccgtacatcgagcattc
gtcgatgcacggacacagatgatcgaggaatcgctcggcaatctctccgcgttctatgcc
atgttccccggcaatggaaagttcaacgtcttcccactgtggctgtcggaagatcatcat
gcccggctttcctcgatatttgctccgcatctcggccatccgcactccgaggatctcgat
gccgagtatctgaatgtcttcgagacacgcacgcgaacgccgttctttcaggacgtgtac
gtcgatggcgtgcgggtgatgctcatccttgggccgaccggcacgggcaaatccgtccat
gggaatcagctcattgccttggaacagaaatacggtggcttcagctacatcttcgacatc
ggtggcagctatgagagtgtcgtcgaattgtacggcggacgggttgaccgcattggcaag
gatggcccccgtgtcaatcccttcgcgctggagccgaccgagagcaacctcaagttcctg
tacaccttcattcgcctgctgctggccaacggcggagccgaactggaacccgaagacgac
gacgtgattcacaaggcggtgcaggatatgtacctgctcgaccgggagaaccgccgcctc
tcgaacctctacctgccgaagaagctcgatcgttacctctcgaaatgggtccgggatggc
gtctaccacgcgatcttcgacaacgtggaggacgggttgtctctctcgcgcgtgcagtgc
ttcgacttcgcgggtgtcaacaacgagcagtatgccgacttgatcgaaccgctaatggtc
tggcttctgcgtcgcatcaacgatgtgctccacgatccggcgaatctcggagtccccaag
cacattctcatcgaggaactcttcccttcgatgaagaatcgccagttgctcgaaggcgcg
ctctcctccatcaagacggtgcgcaagaatctcggcggtgtgacactgatcggccagtcc
gcagaagacctcggcgagaacgcggacagcatcgtgaattcctgctcgtcttttctgtta
ttgaaagacccaaccttcaatcgcaagcgttacgccgaactcttccggatgaatgagcaa
caactggcgctcttcgagagcctgcaggaccgcgaagctctgtacatccgccgcgacggg
ctcacaaaggttgtcatcttgaatctcgacagccgcagctatgccaccttctccaccaag
cccaaggaccgggtacgccggtcgaagttgatcgccaaatacggactcgccgagggtatc
gaccgctttgcccaaggtgaaatcgcctaa

DBGET integrated database retrieval system