KEGG   Acidobacterium capsulatum: ACP_3168
Entry
ACP_3168          CDS       T00868                                 
Name
(GenBank) hypothetical protein
Organism
aca  Acidobacterium capsulatum
SSDB
Motif
Pfam: CagX Chloroa_b-bind
Other DBs
NCBI-ProteinID: ACO32742
UniProt: C1F579
Position
3665110..3665721
AA seq 203 aa
MDWVFDGGHVASRFISIKPKAAGSTTDVHIISDHGNEYTLELQEVSGQADPHFDSKVFLV
PGDKSAKEKLTELPVFVPASELNQAKQEVAAAKAAEARTLKAEQTKEEEYRSRYPGTLRF
DYTWNKSKGDALGLHEIWHDHKFTYLRGQFQETPALYEVKDGKPSLINFDFSNGLYIVPK
ELDRGYLTIGKRKVEFHRTDGGN
NT seq 612 nt   +upstreamnt  +downstreamnt
gtggattgggtgtttgacggaggccatgttgcgagccgatttatcagcattaagccgaag
gccgccggcagcaccacggatgtccacatcatctccgaccacggcaatgagtacacgctg
gaacttcaggaggtttcaggccaagctgatccgcacttcgattccaaagtgttcctcgta
cccggtgacaaatcagcaaaagagaagttgaccgagctgccggtctttgtgcctgcgtcg
gagctgaaccaggccaagcaggaggttgcagcggcaaaagcagcggaggcgagaacgctc
aaggcagaacaaacgaaagaggaagagtaccggagccgctatcccggcacgctccgcttt
gactacacctggaacaagtcgaaaggcgacgcgcttgggcttcacgagatctggcacgac
cacaaattcacctacttacgcggccagtttcaggagacgcctgccctctacgaagtgaaa
gatggcaagccgtctctgatcaacttcgacttctcgaatggcctgtacatcgtgcccaag
gaactcgaccgcggctacctcaccatcggcaagcggaaggtggagttccatcgcacggac
ggaggcaactag

DBGET integrated database retrieval system