KEGG   Acidobacterium capsulatum: ACP_3169Help
Entry
ACP_3169          CDS       T00868                                 

Definition
(GenBank) putative conjugal transfer protein, TrbI family
  KO
K20533  type IV secretion system protein TrbI
Organism
aca  Acidobacterium capsulatum
Pathway
aca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACP_3169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aca02044]
    ACP_3169
Secretion system [BR:aca02044]
 Type IV secretion system
  Trb secretion system protein
   ACP_3169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI DUF3435
Motif
Other DBs
NCBI-ProteinID: ACO34173
UniProt: C1F580
Position
3665724..3666980
Genome map
AA seq 418 aa AA seqDB search
MPELNQNTPATVPEQPEAKPPVRKTMPVVIALVVIMALIGIANLSSLLRGSKRSTSATAM
PIRPAAPNAQEVNSFETQQHLQAERDAQERQHQQEITAAMQQLEAAEGIPGPEGTTTPPM
TAAQRAAIYGQSPNAPVITSSVSEERAEAKQRELAKEKQHRDALASDTVAIDFESSGSTP
ASSHATRSPEAQPDMPATTPTVAPRAKSPNASNAMTPYPFDHYQGKLYRIFEGTILEGVV
TNHIDGGFSGPVLVMLTTDYYSHDHQHLLMPQGTRLIGTVQSIGNAQQRKMFVTFHRAIC
PDGFSIDFDKYIGLDQIGTTGLATKIHHGYFQAFAAAAMIGGLGGLAQIGNNGSILDPST
EIRNGISQQSAAEGEQVLNHFLDRLPVITLKEGSRARVYVGRDILVPSYSEHRMDPNL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactcaatcagaacacgcccgcgacggttcccgaacagcccgaagccaaaccg
cctgtccggaagaccatgcccgtggttatcgcgctggttgtcattatggcgctcatcggg
attgccaatctctccagcctgctcaggggaagcaaacggtcaacatctgcaaccgccatg
ccgatacgaccggcagctccgaatgcgcaagaagtaaacagcttcgagacgcaacagcat
ttgcaggccgaacgcgacgcccaggagcgacagcaccagcaggagatcacggcagccatg
cagcaacttgaagctgcggaaggtattcccggccccgaaggaacgaccactccccccatg
accgccgcgcaacgggccgcgatctatggccaaagtcccaatgctccggtcatcacgtcg
agtgtttccgaagagcgtgcggaggcgaagcagcgcgaactggccaaagaaaagcaacac
agggatgctctggccagtgacacggtcgccatcgactttgagtcttctggttccacccca
gccagttcgcacgcgactcggtcaccggaggcgcaaccggacatgcccgcgacaacgcca
accgtcgctccgagagcaaagtctccaaatgcctccaatgcgatgactccatatcctttc
gaccactaccaaggcaagctttatcgaatctttgagggcacgatccttgagggcgtcgtg
accaaccatatcgacggcggtttcagtggacccgtcctggtcatgctcaccacggactac
tattcgcacgaccatcagcatcttctgatgccacaagggacgcgactgattggaacagta
cagagcatcggcaatgctcagcagcgcaagatgtttgttacgttccaccgtgctatttgc
ccagacggcttttccatcgacttcgataaatacatcggtctagaccagatcggcaccacc
gggctcgctacaaagatccaccacggatactttcaggcgtttgccgccgcagccatgatc
ggcggccttggagggctggcccaaattggcaacaacggcagcatccttgatccctcgacc
gagatccgcaacggcatctcccagcagtcagccgctgaaggcgaacaggtgctgaaccac
tttcttgaccgcctgccagtcatcaccctcaaggaaggctcgcgcgcccgcgtctacgtg
ggccgcgacatcctcgtaccgtcctactcagaacaccgaatggaccccaacctttaa

DBGET integrated database retrieval system