KEGG   Acidobacterium capsulatum: ACP_3258
Entry
ACP_3258          CDS       T00868                                 
Name
(GenBank) hypothetical protein
Organism
aca  Acidobacterium capsulatum
SSDB
Other DBs
NCBI-ProteinID: ACO33399
UniProt: C1F5S4
Position
complement(3778181..3778966)
AA seq 261 aa
MKVSLKKRHWYAIAGGLLLLTATPSFALFGIGDIVFDPTSYANLVSQLTTMETQYRMLKN
NIEHFSFKQQWQTALTEMKQANVRDLFGETEGMTTALNTNSPAASSTAWTAATVPVDDTT
DTYLAAQAAGSAPRSELALIEASDSVSPDCLTAVGQYRAAREQDAAANSSLTAEQLDGGT
ATNSEVEQLNLLNAAQAQKMSEMQSQGVLQACLASEMTIANMRQRDAAAIDLNTAAFVAE
QRTADDASAANEGNTWDTYLP
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaaggtcagcctgaagaaacgtcactggtacgccatcgcgggaggtttgctcttgctg
accgcaacgcccagctttgcgctctttggcattggcgatatcgtctttgacccgaccagc
tacgccaacctggtctcgcagctcaccacgatggaaacacagtaccggatgctgaagaac
aatatcgagcacttttccttcaagcagcaatggcagacggcgctgacagagatgaagcag
gccaatgtgcgggatctctttggggagacagaaggcatgacgaccgcgctcaacaccaac
tctcccgccgcatcgagcacggcatggaccgcggccacggttccggtagacgacaccacc
gatacgtatctggccgcgcaggcggccggctccgccccgcgctcggagctggccttgatc
gaagcatccgattcggtttcgcctgactgtctgactgccgtggggcaataccgcgccgcc
cgggagcaggacgcagcggccaacagcagcctcactgcagaacaactcgacggcggcaca
gccaccaatagcgaagtcgagcagttgaatctcctcaatgcagcccaggcccagaaaatg
tccgagatgcaatcgcagggcgtattgcaggcatgcctggcatcggagatgacgatcgcc
aacatgcgccagagggacgccgccgctatcgatttgaatacagccgcattcgttgccgag
cagcgtaccgccgacgacgccagcgcagccaacgaaggcaacacctgggatacctacctg
ccatga

DBGET integrated database retrieval system