KEGG   Acidobacterium capsulatum: ACP_3481Help
Entry
ACP_3481          CDS       T00868                                 

Gene name
rbsK
Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACP_3481 (rbsK)
Enzymes [BR:aca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ACP_3481 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin RecO_N_2
Motif
Other DBs
NCBI-ProteinID: ACO32399
UniProt: C1F711
Position
4037302..4038240
Genome map
AA seq 312 aa AA seqDB search
MPEQRKPILVMGIFALDLAFRTHKLPAWGETVVGSSLATAPGGKGTNQAIAAARLGAETY
FLSKIGMDAFGHIAEAAYREAGVRTDFLRRDPHAATGAAAILLDDASGENAIVVSPGSAS
ALTTAEIDAAHEAIARSACFLTQCELPLPLVRHALGLARSLGVPTVLNPAPAVAGAESLL
PLCDFVTPNEHEAQALTGLPVSTLAEAEAAADVLLARGARHAILTLGARGAYVKSATLKQ
HIPAFDAGPVVDTTGAGDAFNAGFAAALAEGMGVIRAARFGCAVAGIAVTRPGTSPSMPR
RHEVEALLARHA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacagcgcaaacctattctcgtcatgggcatcttcgccctagatctcgccttc
cgcacgcacaagctgcccgcctggggagaaaccgtcgtcggctcctcgctcgccaccgcc
cccggcggcaaagggaccaaccaggccatcgccgccgcgcgcctcggtgcggagacatac
ttcctcagcaaaatcggcatggatgcctttggccacatcgccgaagccgcttatcgtgag
gccggcgtgcgcaccgattttctccgccgcgacccccacgccgccaccggtgcggccgcc
atcctgctcgatgacgcaagcggcgaaaacgccatcgtcgtctcgcccggctccgccagc
gcgctcaccactgctgaaattgatgccgcccacgaagccatcgcccgctcggcctgtttc
ctcacgcagtgcgagcttccgctgccgctcgtccggcacgcgctcggcctcgcgcgctcg
ctcggcgtgcccactgttctcaatcccgcgcccgccgtcgccggggcagagagcctgctg
ccgctctgcgatttcgtcacgcccaacgagcatgaggcgcaggcgctcaccggcctgcct
gtctccacgctggccgaggcagaggctgcggccgatgtgctgctcgcacgcggcgcacgc
catgccatcctcacgctgggcgcgcgaggagcttacgtcaaaagcgctacactgaagcag
cacattcccgccttcgacgccgggcctgtggttgataccaccggcgcgggcgacgccttc
aacgcgggcttcgccgccgctctggccgagggcatgggtgtgattagagccgcgcgtttt
ggatgcgccgtggcgggcatcgcagtcacgcggcccggcacctcgccctccatgccgcgc
cgccacgaagttgaagctctgctcgcgcgccacgcctga

DBGET integrated database retrieval system