KEGG   Acidobacterium capsulatum: ACP_3493Help
Entry
ACP_3493          CDS       T00868                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00010  Glycolysis / Gluconeogenesis
aca00071  Fatty acid degradation
aca00350  Tyrosine metabolism
aca00625  Chloroalkane and chloroalkene degradation
aca00626  Naphthalene degradation
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01120  Microbial metabolism in diverse environments
aca01130  Biosynthesis of antibiotics
aca01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP_3493 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    ACP_3493 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACP_3493 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ACP_3493 (adh)
   00626 Naphthalene degradation
    ACP_3493 (adh)
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ACP_3493 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N adh_short
Motif
Other DBs
NCBI-ProteinID: ACO32373
UniProt: C1F723
Position
4056621..4057637
Genome map
AA seq 338 aa AA seqDB search
MKAAVVREFGKPLTIEERAIPEPGPEEIQVKIEACGVCHTDLHAAHGDWPVKPNPPFVPG
HEGVGFVSGVGKSVKHIKEGDRVGIPWLYSACGVCEHCLAGWETLCEKQQNGGYSVDGGF
AQYALADPNYVAHIPANVDFYEIAPVVCAGVTVYKGLKMTEAQPGEWVVISGIGGLGHLA
VQYAKAMGMHVAAVDVAPDKLALAKKLGATLTINAKEQDPVAYLKKEIGGAHGVLVTAVS
PKAFEQALGMVRRGGTVALNGLPPGSFPLPIFDMVLNGITLRGSIVGTRLDMSEALSFAA
EGLVHATIAKARLEEINAVFAKMEAGGIDGRIVLDVNT
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcggtagtgcgcgagtttggcaagccattgacgattgaagagagggcgatt
cccgaaccgggtccggaagagattcaagtgaagatcgaggcctgcggcgtttgccacacc
gacctgcatgcagcccatggcgactggcctgtgaagccgaatccaccttttgttcccggc
cacgaaggcgttggatttgtctctggcgtgggcaagtcggtcaagcacattaaagaggga
gaccgcgtgggcattccctggctctactccgcctgcggcgtatgcgagcactgccttgcc
ggatgggaaacactctgcgagaagcagcagaacggcggctattccgtcgatggaggcttt
gcgcagtatgctctcgctgaccccaattacgtcgctcacattccagccaatgtcgatttc
tatgagatcgcgccggtggtctgcgccggggtcaccgtctacaagggactcaagatgacc
gaagcccagccgggcgagtgggtcgtcatttcaggcatcggcggcctcgggcatctggcc
gtgcaatatgccaaagcgatgggcatgcatgtggcggcggtcgatgtggccccggacaaa
ctggctctcgccaaaaagctgggcgcaaccctcacgataaatgccaaagaacaagacccc
gtggcctacctcaaaaaagaaatcggcggcgcgcacggtgtactcgtcaccgctgtttct
cccaaagcctttgagcaggctcttggaatggtgcgacggggcggaactgtggcattgaat
ggattgccgccgggttcgtttcctctgcccatctttgacatggtgctcaacggcatcact
ctgcgcggctctatcgtcggcacacgtttggatatgagcgaggcgctttcctttgcagct
gaagggctcgtgcatgccaccatcgccaaagccaggctcgaagagatcaatgccgtattc
gcaaagatggaagccggcggcatcgacggacgaattgttcttgacgtcaacacgtag

DBGET integrated database retrieval system