KEGG   Anaerostipes caccae: EYQ97_04365
Entry
EYQ97_04365       CDS       T06754                                 

Definition
(GenBank) (2Fe-2S)-binding protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
acac  Anaerostipes caccae
Pathway
acac00230  Purine metabolism
acac01100  Metabolic pathways
acac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EYQ97_04365
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: QMW70565
Position
complement(893930..894418)
AA seq 162 aa
MEQQKKLITCTVNGHEVAEYVDVRESLLEMLRNRLGLTSVKKGCEVGECGACTVIVDGET
IDSCIYLAVWAQGKQIRTLEGLMGPNGELTRIQEAFIEEGAIQCGFCTPGFIMSATVLLE
RGEKTLTRDMIRKHMAGNLCRCTGYENIVNAVQKVHKENQSL
NT seq 489 nt   +upstreamnt  +downstreamnt
atggaacagcagaaaaaacttataacctgtacggtcaacggtcatgaagtggctgaatat
gtagatgtgagagaatcccttttagaaatgctcagaaaccgccttggcctgacttccgta
aaaaagggctgtgaggtgggtgaatgcggtgcctgtacggtcattgtggatggagagacc
atcgattcctgtatttatctggccgtgtgggcccagggaaaacagatccgcactctggaa
ggcctcatgggaccgaatggagaactcacaagaatccaggaggcatttatcgaagaaggc
gccattcagtgcggcttctgcaccccgggttttattatgtccgccacagtccttctggaa
cgaggtgaaaaaaccctgactcgggatatgatccggaaacatatggcaggaaacctctgc
cggtgtacgggctatgaaaatatcgtaaatgcggtgcagaaggtacacaaggaaaaccaa
tccctgtaa

DBGET integrated database retrieval system