KEGG   Anaerostipes caccae: EYQ97_04375
Entry
EYQ97_04375       CDS       T06754                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
acac  Anaerostipes caccae
Pathway
acac00230  Purine metabolism
acac01100  Metabolic pathways
acac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EYQ97_04375 (xdhA)
Enzymes [BR:acac01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     EYQ97_04375 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QMW70567
Position
complement(895310..897595)
AA seq 761 aa
MRTVGQSIKRVDAYEKVSGRAKFTDDLIPKHCLTAKVLHAPIASGIVASIDTSEAEALEG
VVKVVTFRDVPKHTYPTPGHPWSVEPSHQDTADRRLLTGRIRYYGDDVAAVIAEDEVTAS
RALKLIRTEYEEYAPVLHPRDAMKGTIPPVHEEHPDNILAKSSYEIGHVDDALSQADAVL
SESFRTPIVQHCHIEPPISYAYMEKDRIVVVCSTQIPHIVRRVIGQALGIPWGKVRVIKP
YIGGGFGNKQEVLYEPLNAFLTASVGGRPVKLELSREETFTNTRTRHSIEYDLTAGVTKD
GKILAKDMKAYSNQGAYASHGHAIAANGATAWRHLYDVKNIRADAYTVYTNAPVGGAMRG
YGIPQFCFVSECLMDDLACKISMDPLKFRELNLYDGYFEDPVLTPLAANTNGVRECMRRG
ADYIHWEEKRSLYQNQSGNIRRGVGMALFSYKTGVWPISLEISGARLILNQDGSVQLQTG
AAEIGQGSDTVFTQMAAEVLGLSPDDVHIQSFQDTDITPFDTGAYASRQTYISGTAVKEC
AELLKEKILTYARTLVAEEYRDQELSLYDKQILCGRKPVLSLEELAFHSYYSRTSSAAIT
SDVSRQIKKNTLAFGACFAEIEVDLKLAKIKILDIINVHDSGKIINPQLASMQVHGGMSM
GIGYGLSEQMLLDEKTGRVLNGSLLDYKLPTMMDSPDLHLDFVELEDPTGPFGNKALGEP
PAIPPAPAIRNAFLHATGIPVNEIPLSPQRVFEALKKADLI
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgagaactgttggtcaaagcataaaaagggtggatgcttacgagaaggtatccggaaga
gccaaatttaccgatgatctgatcccgaagcattgtctcactgcgaaagtgctgcatgct
cccattgccagcggtattgtcgcttctatagacacaagtgaggcggaggccctcgaaggg
gtagtaaaagtcgtcaccttccgtgacgtcccaaaacatacatatcccactcccggccat
ccctggtccgtagagccgtctcaccaggatacggcggaccgccgtctgctgaccggtaga
atccgttattacggcgacgatgttgccgccgtgatcgccgaagatgaagtcaccgcttcc
agggctttaaaactgatccggacagagtacgaagaatatgccccggtgcttcatccccgg
gatgccatgaagggaaccattccgccggttcacgaagaacatccggacaatattcttgca
aagagcagctacgagatcggacatgtggacgatgcactctcgcaggcagatgccgtactc
agcgaaagtttccgcacccctatcgtccagcactgccacattgagccgccgatttcctat
gcctacatggaaaaagacaggatcgttgtcgtatgttccacccagatcccccatatcgtg
aggagagtcatcgggcaggccttgggcatcccatggggaaaagtccgtgtcataaagcca
tatatcggcggaggcttcggcaacaaacaggaggttctctatgaacctctcaatgcattt
ctgactgcctctgtcggcggccgtccggtgaaactggagctttccagagaggaaacgttt
acaaacaccaggacccgccattccattgaatatgacctgacggcaggcgtaacaaaagac
ggtaaaattctcgccaaagatatgaaagcctattccaaccagggggcctacgcctcacac
ggccatgccatcgcagccaacggcgctaccgcatggcgccatttatatgatgtaaaaaat
atccgggccgatgcttataccgtctatacaaatgcaccggtaggcggagccatgaggggc
tatggtatcccccagttctgcttcgtatccgaatgtctgatggatgatctggcctgtaaa
atttccatggacccgttaaagttccgggagctcaacctatatgacggatattttgaagat
cctgttttaactcctctcgccgcaaacaccaacggcgtcagagagtgtatgaggcgcgga
gcagactacatacactgggaggaaaaacgcagcttataccaaaaccagtccgggaatatc
cggcgcggtgtgggcatggctttgttcagctataagaccggtgtatggcccatttccctg
gaaatatccggagccaggcttatcctcaatcaggacgggagtgtccagctccagaccggc
gccgcagaaatcgggcagggttccgacactgtatttacacagatggcggcggaggtcctg
ggtctttcccctgatgacgtccacattcagtcctttcaggatacggacattacccctttt
gacacgggagcttacgcttccagacaaacttatatcagcggcaccgccgtcaaagaatgt
gccgaactcctgaaagaaaaaattcttacctatgccaggactctggttgctgaagaatac
agggatcaggagctttctctgtatgataaacagatcctctgcggtcggaagccggtcctg
tcccttgaagaactggcttttcacagctattacagcaggacttcttctgccgccatcacg
tcggatgtatcccggcagatcaagaaaaacacccttgcgttcggagcttgttttgcggaa
attgaagtagatttaaaactagctaagattaagatactcgatatcatcaatgtccatgac
agcggaaagatcatcaatccacagctggcctccatgcaggtccacggcggcatgtccatg
ggcataggctatggtctgagtgagcagatgctcctggatgaaaagaccggacgcgtactg
aacggcagcctgttagactacaagcttcccactatgatggactccccggatctccattta
gactttgtggaacttgaagatccaacgggcccgttcggaaacaaggctcttggcgagcct
cccgcaatccctcctgctccggccatccgcaatgcttttcttcacgcaaccgggattccg
gtcaatgaaatccctctttcacctcagagggtatttgaggcattaaaaaaagctgatttg
atataa

DBGET integrated database retrieval system