KEGG   Actinoalloteichus fjordicus: UA74_21040
Entry
UA74_21040        CDS       T04639                                 

Definition
(GenBank) xylose isomerase-like enzyme
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
acad  Actinoalloteichus fjordicus
Pathway
acad00525  Acarbose and validamycin biosynthesis
acad01100  Metabolic pathways
acad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acad00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    UA74_21040
Enzymes [BR:acad01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     UA74_21040
SSDB
Motif
Pfam: AP_endonuc_2 PGA_cap
Other DBs
NCBI-ProteinID: APU16233
Position
4986815..4987657
AA seq 280 aa
MSPARRHRDGCAVGLVDWRLPEAGPDAVRRAGEVGVDGVQLDLGGPGRGPRLDAPGRLDA
VRDAVEATGVRVLAVAGNHLNDIGLTARADSHDATRVRLFFERLLDAAQALGAPLAFAPS
FGRSVIDGPEAFARTAAVLRAAARAAAERGLLLGSENVLGAHQARRLAEAVDSPALRLVL
DPANLVAAGLHPIELIGATSELLADQVHLKPPPDAGPSGADLDSTMVTETLVALREQHVP
VRVLVSENDYRDGDADRLAREVDQLRRRAAWFVPSTIETT
NT seq 843 nt   +upstreamnt  +downstreamnt
gtgagtccagcgcgacgtcaccgcgacggctgcgcggtcggcctggtcgactggcggctt
ccggaggccggccccgacgcggtgcggcgcgcgggcgaggtcggggtcgacggcgtgcaa
ctcgacctcggcgggccgggtcgcgggccgcgcctggacgcccccgggcgcctcgatgcc
gtccgggatgccgtcgaggcaacgggagtccgggtgctggccgtggcaggaaaccacctc
aacgacatcgggctcaccgcgcgggcggacagccacgacgccacccgagtacggctgttc
ttcgaacggctgctcgacgccgcacaggccctcggtgcgccactggccttcgcaccgagc
ttcgggcgcagcgtcatcgacggtccggaggccttcgcccgcacggcggcggtgctgcgg
gcggccgcgcgcgcggcggcggaacggggcctcctgttgggcagcgagaacgtcctcggc
gcgcaccaggcgcggcggctcgccgaggccgtcgactcccccgcgctgcgactggtgctc
gacccggcgaacctcgtcgcggcgggcctgcacccgatcgaactgatcggtgcgacctcg
gagctgctcgccgaccaggtccatctcaagcccccacccgatgcgggcccgtcgggtgcg
gacctcgactcgaccatggtgaccgagacgctggtcgccctgcgggagcagcacgtcccc
gtccgagtactggtgtcggagaacgactaccgggacggcgacgcggaccgtctcgcccgc
gaggtcgatcagctgcgacggcgggcagcctggttcgtcccgagcacgatcgagacgaca
tga

DBGET integrated database retrieval system