KEGG   Actinoalloteichus fjordicus: UA74_27955Help
Entry
UA74_27955        CDS       T04639                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
acad  Actinoalloteichus fjordicus
Pathway
acad00620  Pyruvate metabolism
acad00630  Glyoxylate and dicarboxylate metabolism
acad01100  Metabolic pathways
acad01110  Biosynthesis of secondary metabolites
acad01120  Microbial metabolism in diverse environments
acad01200  Carbon metabolism
Module
acad_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UA74_27955
   00630 Glyoxylate and dicarboxylate metabolism
    UA74_27955
Enzymes [BR:acad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     UA74_27955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: APU17592
Position
complement(6584525..6586129)
Genome map
AA seq 534 aa AA seqDB search
MSDQTEQGAQVLGAPVERGEEILTPEALRFLAGLHRRFDPRRRELLSRRVLRREDAVRRG
GLDFSPETAEIRESDWRVAPAPADLRDRRVEITGPTERKMTINALNSGAEVWLADLEDAN
TPHWENVVGGQINLFDAVRRTISHTGPDGRSYTLREDVDPAVIVVRPRGWHLSERHLRVD
GEPIAGALVDFGLHFFHNAAELLARGSGPYYYLPKLESSLEARLWNEVFVHAQQELRVPV
GSVRATVLIETIPAAFEMDEILYELREHAAGLNAGRWDYLFSIIKTFRDAGASFVLPDRS
GVTMTAPFMRAYTELLVRTCHRRGAHAIGGMAAFIPNRRDEQATATALAKVREDKEREAA
DGFDGSWVAHPDLVPLCREVFDKALGDAPNQLDRTRDDVRVAPRQLLDVASAGGAVTEGG
LRAAVDVGIRYLVAWLGGNGAVAIHNLMEDAATAEISRSQLWQWVHNGVQLDTGATVDVE
LVREAAQQVRESLLAELPADQADRLDEAVELFEEVALAERFVDFLTLPATELLP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcagaccgagcagggcgcccaggtgctgggagcgcctgtcgagcgcggcgag
gagatcctgacgcccgaggcgctgcgtttcctcgccggtctgcatcgtcgtttcgacccg
cgacgacgggagctgctgtccagacgagtcctgcgcagagaggacgcggtccgccgtggc
ggcctggacttttcgcccgagacggccgagatccgggagtccgactggcgggtcgcaccc
gcacctgcggacctgcgtgatcgccgggtcgagatcaccggtcccaccgagcgcaagatg
acgatcaacgcactcaactccggcgcggaggtctggctggccgatctggaggacgccaac
accccgcactgggagaacgtcgtgggcgggcagatcaacctgttcgacgccgtacgacgg
acgatctcgcataccggtccggacgggcgctcgtacaccctgcgcgaggacgtcgacccc
gccgtcatcgtcgtgcgcccccgaggctggcacctgtcggaacgacacctgcgcgtcgac
ggcgagccgatcgccggggcactggtcgacttcggcctgcacttcttccacaacgccgcc
gagctgctggccaggggaagcggcccgtactactacctgccgaagctcgagagcagcctg
gaggcccgactgtggaacgaggtcttcgtccacgcccagcaggagctgcgggtgccggtg
ggcagcgtccgggccaccgtgctgatcgagacgatcccggccgccttcgagatggacgag
atcctctacgagctgcgtgagcacgccgccggactgaacgccggacgctgggactacctg
ttcagcatcatcaagaccttccgcgacgcgggcgcgtccttcgtgcttcccgatcgcagc
ggcgtcacgatgaccgcccccttcatgcgtgcctacaccgaactgctggtccgcacctgc
catcgacggggcgcgcacgccatcggcggcatggcggccttcatcccgaaccggcgggac
gagcaggccaccgccaccgccctggcgaaggtgcgcgaagacaaggaacgcgaggcggcc
gacggcttcgacggctcctgggtcgcccacccggacctcgtcccgctgtgccgggaggtc
ttcgacaaggccttgggcgacgcgccgaaccagcttgatcgcaccagggacgacgtgcgt
gtcgcgccacgacaactgctcgacgtcgcctcggcgggcggcgccgtcaccgagggcggg
ctgcgcgcggccgtcgacgtcggcatccgatacctcgtcgcctggctcggcggcaacgga
gccgtcgcgatccacaacctgatggaggacgcggccacggcggagatctctcgctcgcag
ctctggcagtgggtgcacaacggggtgcagctcgacacgggcgccaccgtggacgtcgag
ctggtgcgcgaggccgcgcagcaggttcgtgagtcgctgctggccgaactgcccgccgac
caggcggaccggctcgacgaggcggtggagctgttcgaggaggtcgccctcgccgagcgg
ttcgtggacttcctcaccctgcccgcgacggagctgctgccctag

DBGET integrated database retrieval system