KEGG   Acinetobacter calcoaceticus: BUM88_02325Help
Entry
BUM88_02325       CDS       T05452                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal00270  Cysteine and methionine metabolism
acal00920  Sulfur metabolism
acal01100  Metabolic pathways
acal01110  Biosynthesis of secondary metabolites
acal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acal00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BUM88_02325
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BUM88_02325
Enzymes [BR:acal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     BUM88_02325
    2.3.1.46  homoserine O-succinyltransferase
     BUM88_02325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Peptidase_S9 Esterase
Motif
Other DBs
NCBI-ProteinID: AQZ80549
UniProt: A0A0A8XIN7
Position
complement(480074..481234)
Genome map
AA seq 386 aa AA seqDB search
MSFPADSVGLVTPQKFQFEEPLHLECDRVLPRFELMVETYGTLNADKSNAILICHALSGH
HHAAGYHHEDDKKAGWWDSCIGPGKAIDTNKFFVVSLNNIGGCNGSTGPTSPNPENDNRP
YGPDFPLVTVRDWVKTQAMLSDRLGVNIWYAVIGGSLGGMQALQWSVDYPDRLQKCVIIA
SAPKLSAQNIAFNEVARQSILSDPDFHHGRYLENDSYPKRGLILARMVGHITYLSEEAMK
QKFGRDLKSGKFMYGFDVEFQVESYLRYQGEQFSRNFDANTYLIMTKALDYFDPSREYNH
SLTDAMGKTKCQFLIVSFTTDWRFTPSRSQEIVDALITNHKPVSYLDIDAEQGHDSFLFP
IPLYVKTMRAFLGGEELLKSTSLEAS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttttccagctgattcagtggggttagtcactccgcaaaagttccaatttgaagaa
ccattacatcttgaatgtgaccgtgttttgccacgttttgaattaatggtcgaaacgtac
ggcactttaaatgcagataaatcaaatgccattttaatctgtcatgccttatctggacat
catcatgcagcgggctatcaccacgaagatgataaaaaagctggctggtgggatagttgt
attggcccgggtaaagcaatcgacacgaataagttttttgtagtttcgctaaataatatt
ggtgggtgtaatggctcaactggcccaacgtcaccaaatcctgaaaatgataatcgccct
tatggaccagatttcccattagtaacggtacgtgactgggtaaaaactcaagccatgctt
tctgaccggttgggtgtaaatatttggtatgccgttattggtggctctttagggggcatg
caggcactacaatggtcggttgactatcctgaccgcttacaaaaatgtgtgattattgcc
agtgcgccaaaactttcagcacaaaatattgcatttaacgaagttgcacgccagtctatc
ttgtctgatccagacttccatcatggtcgttatttggaaaatgatagctacccaaaacgc
ggcctgattttggcccgaatggtaggtcatatcacctacctctctgaagaagccatgaaa
caaaaatttggtcgtgatttaaaatctggcaaatttatgtacggttttgatgtcgagttt
caggttgaaagttaccttcgttatcaaggcgaacagtttagccgtaactttgatgccaat
acttatctcatcatgaccaaagcattggattattttgatccatcacgtgaatacaaccac
tcgttaacagacgcgatgggtaaaacaaaatgtcagttcctgatcgtttcttttacaaca
gactggcgttttacaccaagtcgctctcaagagattgttgatgcactcattaccaatcat
aagccagtaagttacctcgatattgatgcggaacagggacatgactcgttcttattcccg
attccattgtatgtaaaaacaatgcgcgctttcttaggcggtgaagaactcttaaaatcg
acgtcactggaggcaagctaa

DBGET integrated database retrieval system