KEGG   Acinetobacter calcoaceticus: BUM88_17355Help
Entry
BUM88_17355       CDS       T05452                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
acal  Acinetobacter calcoaceticus
Pathway
acal03010  Ribosome
Brite
KEGG Orthology (KO) [BR:acal00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BUM88_17355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:acal03011]
    BUM88_17355
Ribosome [BR:acal03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BUM88_17355
  Bacteria
    BUM88_17355
  Archaea
    BUM88_17355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF1442
Motif
Other DBs
NCBI-ProteinID: AQZ83219
UniProt: A0A0A8XEG0
Position
complement(3599088..3599417)
Genome map
AA seq 109 aa AA seqDB search
MEVTAKLRGAAISAQKARLVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEH
NNSLDVDDLKVSTIYVDEGVSLKRIMPRAKGRADRITKRTCHITVKVGV
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaactgctaaattacgcggtgccgctatctcggcacaaaaggcacgtttggtt
gcagatcttattcgcggcaaatctgttgcgcatgctttaaatattttgaacttcagcaat
aaaaaagctgctgttttagtaaaaaaagcattggaatctgcgattgcaaacgctgaacac
aataacagtttagatgttgatgatcttaaagtttctacgatttacgttgatgaaggcgtt
agccttaaacgtattatgccacgtgctaaaggccgtgcagatcgtattactaagcgtact
tgtcacatcaccgttaaggtaggggtttga

DBGET integrated database retrieval system