KEGG   Acanthamoeba castellanii: ACA1_000330Help
Entry
ACA1_000330       CDS       T02667                                 

Definition
(RefSeq) Myotubularin, putative
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00562  Inositol phosphate metabolism
acan01100  Metabolic pathways
acan04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ACA1_000330
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    ACA1_000330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acan01009]
    ACA1_000330
Enzymes [BR:acan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     ACA1_000330
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     ACA1_000330
Protein phosphatases and associated proteins [BR:acan01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    ACA1_000330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related
Motif
Other DBs
NCBI-GeneID: 14919578
NCBI-ProteinID: XP_004340837
UniProt: L8H1Z4
Position
Unknown
AA seq 1068 aa AA seqDB search
LRRKARICFSFPLTIITKITKVGPITTEAGNYRGLQVVLKDFRTYYFCSIPFTSIRKPKM
DTFFQVLEDHTFPTRLSDFFAFAHRSALAAEAECPKVNARTPHYSRAVRKAIAEPHLASW
KAESPLIHFSDGFASADSGDSFPTRRFPRVGRARQPLSRSERERLINEQAARSGDASPTT
DGQQNIDHESGSSASAAQGADGSTLGHVEELGQLKSELFGMASQSPVAAPLFAKEVEARW
AATKPPSASPEPKDRDKLLSSPFLSSRTIAQNGWELYLPMDDYGRLELDVSPWRISPINW
DYSLCETYPRLLVVPASVSDEDIKQVKQFRSKGRIPVPTWRHKESGSIIVRCSQPKTGLL
SDRSEQDEKLVSSIRQACGTKCTVYLIDARPRVNAVMNTLTGAGVENAAVYNIHHDNRIF
LGIPNIHVVRDSGSRLTKIIDVWNLTTTLNDMTGADGVTGSHDPIQTSGADSSERLAQKQ
TELRLLDKGVGHGRRLDRTPQLVALAQLLLDPHYRTIHGYEILIEKEFLSFGHRFQDRCG
HHGKKEKDQRSPIFHQFLECTWQLLQQFPSAFEFNELFLETVLEHVYSCRFGTFFMNSAK
ERADSQLAERTCSLWTTINGFGSDGEDVGVFSPEDVETPAGAAADAASLVRVSSTEKPAA
PSTPKASQSQSSDDDEREEVVAKGEESVDWDAVMRRRRKYVNPRYIHGRHHHLMPVVNLC
QRDPSLSAAATTSPPPPANAARKLSGTAAAELRRRNSAPDPQDGAMAAGTEHEGRAGPRR
KSSASKPSPRSPRSPLGFASTVSGDIHAGGPLSDNGSDDDELLSDPDLDDEFEVVDHAAS
EEEQAATAAAAAAAARDKGAKGGGGLAGLGREDVEDMLEYLGNKWRRAGIGLYHAAIDRT
RGPGPEVGSIRFWAALYLRWRRGDVLFPTTLPAGFLSPASMPASPALPDAPATMVVAAAA
AAPTTAVTTTIAQSRSPPASPKRLRRSASSAPALSAGRYSAPVAASPHEVPDSLASTLSG
GPTVHARKTNSGELSLHTRVQLGELKRAATKTKADAALFSLSRSSRAD
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
ctgcggagaaaggcgcgcatttgcttctcgtttccgttgaccatcatcaccaagatcacc
aaggtcggacccatcactactgaggctggtaactatcgtggcctccaggtcgtgctcaag
gacttccgcacctactacttctgctccattcccttcacctccatccggaaacccaagatg
gataccttctttcaggtgcttgaggatcacaccttcccgactcgcttgagcgatttcttc
gccttcgcccatcgaagcgcgctggcggccgaagccgagtgtcccaaggtcaatgcccgc
acgccacactacagccgagccgtgcgcaaggccatcgcagagccgcatctggcctcgtgg
aaggccgagtcgccgctgatccacttcagcgatggatttgcctcggccgacagcggcgat
tcattccccacacgccgcttcccgcgcgtggggcgtgcccgacagccgctctcgcgaagc
gagcgggagcgactcatcaacgaacaagccgcccgatccggggacgccagcccaacaacc
gacggccagcagaacatcgaccacgaaagcggatcaagcgcaagtgcagcacaaggtgca
gatgggagcacattgggccacgtcgaagagctgggccagctgaaaagcgagctctttggc
atggcgtcccaatcacccgtcgcagctccgctcttcgcgaaggaggtcgaagccaggtgg
gccgccactaagccgccaagtgcttcgccggagccgaaggatagggacaaactgctaagc
tcgcccttcctgtcatcgcgcaccatcgcacagaacgggtgggagctctacttgcccatg
gacgactacggccggctagagctggacgtatcgccctggcgcatctcgcccatcaactgg
gactacagcctgtgcgagacctatccccgcctactggtggtgccggcctcggtaagtgac
gaggacatcaagcaggttaagcagttccgcagcaagggcagaattcctgtgccgacgtgg
cgccacaaggagagcgggtccattatcgtgcggtgcagccaacctaaaaccggtctgttg
agcgaccgctccgagcaggatgagaagctggtatcatccatcaggcaggcctgcggcacc
aaatgcacggtgtacctcatcgacgcccgaccgagggtaaacgcagtcatgaatactctt
actggtgccggggtggagaacgcggcggtgtacaacattcaccacgacaatcggatattc
ttgggcatcccgaacatccacgtcgtgcgggacagcggctcgcggcttaccaagatcatc
gacgtgtggaacctcaccacgacgctcaatgatatgacaggagccgacggcgtcacaggg
tcccacgatcccattcaaacgtcgggtgcggacagcagcgaacgcctggcgcagaagcag
accgagctgcggttgctcgacaaaggtgttggacacgggcgacggctggaccgcacgccg
cagctggtcgcgctggcccagctgctcctcgacccgcattaccgcacgattcacggctac
gagatcttgatcgagaaggagttcctcagcttcggccacaggttccaggatcgctgtggc
caccacggcaagaaagagaaggaccaacgatcgccgatctttcatcagtttttggaatgc
acgtggcagctgctccagcagttcccttcggcattcgagttcaacgaactcttcctggag
accgtgctggagcacgtctactcctgccgcttcggcactttcttcatgaactcggccaag
gagcgggcagacagccagctggccgagaggacttgctccctgtggacgaccatcaacggg
ttcggcagcgacggcgaagacgtgggtgtttttagccctgaggacgtggagacaccggcg
ggcgcggcggccgacgctgcgtcgctcgtgcgggtcagctccaccgagaaacccgcagcg
ccgtcgacgcccaaagccagccagagccagagcagtgacgacgatgagagggaggaggtc
gtcgcgaagggcgaggagagcgtggactgggatgccgtgatgcgacgcagacgcaagtac
gtcaacccgcgctacatccacgggcggcaccaccacctgatgccggtggtcaacctctgc
cagcgcgacccgtcgctcagcgcagccgccaccacgtcgccgccaccaccggccaatgcg
gcgcgcaagctctcgggcacggcagcggcggagctcaggcgacgcaacagcgcgcccgac
ccgcaggacggcgccatggccgccgggaccgagcacgaaggtcgtgcaggtccccggcgc
aagtcgtcggcctcgaagccctccccgcgctcgcccaggagtccgctgggctttgccagc
accgtgtcgggcgacatccacgccggaggcccgctcagcgacaatggcagcgacgacgac
gaactcctcagcgaccccgatctcgacgacgagttcgaggtggtcgaccatgccgcctcc
gaagaggagcaggcggccaccgcagcagctgcggccgcagcggcgagggacaagggcgct
aagggcggcggcgggctggcgggcctggggcgcgaagacgtggaggacatgctcgagtac
ctggggaacaagtggcgccgcgccggcatcggactctaccacgccgcgatcgaccgcacc
cgcgggccggggccggaggtgggctcgatccgattctgggccgccctctacctgcggtgg
cgccgcggcgacgtgctcttccccaccacgctgccggccggcttcctctcgccggcgtcg
atgccagcgtcgccggccctccccgacgccccggcgacgatggtggtggcagcggccgcg
gcggcgccgaccacagccgtcacgacgaccatcgcccagagccgctcgccgccagcgtcg
cccaagcgactgcgccgatcggcgtcgagcgcgcccgccctgtcggccggccggtactcg
gcgcccgtggctgcgtccccgcacgaagtgcccgactcgctggcctccaccctgtccggc
ggaccgaccgttcacgcccgcaagaccaactcgggcgagctgtcgctgcacacgcgcgtg
caactgggagagctcaagcgggcggcgaccaagacgaaggccgacgctgcgctcttctcc
ctttcacgatcatcccgcgccgattga

DBGET integrated database retrieval system