KEGG   Acanthamoeba castellanii: ACA1_005320Help
Entry
ACA1_005320       CDS       T02667                                 

Definition
(RefSeq) DEAD/DEAH box helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
acan  Acanthamoeba castellanii
Pathway
acan03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:acan00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    ACA1_005320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:acan03041]
    ACA1_005320
Enzymes [BR:acan01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     ACA1_005320
Spliceosome [BR:acan03041]
 Complex C
  Other components
   Step II factors
    ACA1_005320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 Helicase_C OB_NTP_bind DEAD DNA_pol3_delta
Motif
Other DBs
NCBI-GeneID: 14916428
NCBI-ProteinID: XP_004337788
UniProt: L8GS15
Position
Unknown
AA seq 572 aa AA seqDB search
MVVTARQRLIEEFLHEAGLAKTGMVGVTQPRRVAAMTVAKRVAQEMGTQLGEGVGYTIRF
EDVTSPNTKVKFLTDGMLLREAMLDPMLKSYSVIILDEAHERTLHTDVLFALIKGIMVKR
KDLRLVIMSATLEAEKFAEYFRQFPVDVYYADEKEVQPLYLVDYMDAALLTVLQLHLEKP
AGDILLFLTGQEEIEHMTKLLEQKARTFGPEAMKARRSFSRFCSSDVILATNIAETSITI
PGIKYVIDTGVVKERMYNAKIGIDSLTVVPVSKAAARQRSGRAGRESAGECYRLYREESF
LRFAESQVPEIKRANMASVVLQLKALGIQDVTRFDYMDPPPLDSLKKSIELLTVLGALDS
ENKLTSPIGRNMAALPLDPLLSKTLIMSEKFGCTEEILIIVAMLSGESIFFVPRGDKKKQ
AELAHRRFHSIEGDHITLLNIYKAYQQATNKNNFCYESFINSRTIKHIQEVWRQLGDYCR
QLGIERKSCGENTETIRRCLTSGFFLKAALAKIHPSSVLFTKKPLCVLYNQLVMTKQKYM
REVVVIDQNWLVELAPNFYAKRSVVGSHRQGK
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcacagcccggcagcgtttgatcgaggagtttctgcacgaggcggggcttgcc
aagactggaatggtcggtgtgacgcagcccaggcgtgtggcggcgatgacagtggccaag
agagtggcgcaggagatgggcacccagctcggcgagggtgtgggctacaccattcgtttc
gaagacgtcacctctccgaacaccaaggtcaaattcctcaccgacggtatgctgctgcga
gaggccatgctcgaccccatgctcaagagctattctgtgatcattctcgatgaggctcac
gagcgcacactccacaccgacgtgctctttgcactcatcaagggcatcatggtcaagagg
aaagacctacgactggtgatcatgtctgccaccttggaggcggagaaatttgctgaatac
ttcagacagttccccgttgatgtttactacgccgatgaaaaagaggtccagcccctctat
cttgtagattacatggacgccgcacttcttacggttcttcaacttcatctggagaaaccc
gcaggcgacattctgctcttcttgacgggtcaggaggagatcgaacacatgaccaaactg
ctcgagcagaaggcccgcactttcggccctgaggccatgaaggcacgccgcagcttcagt
cgtttctgttcttctgatgtgattctggccaccaatattgcggagacctccatcacgata
cccggtatcaaatacgtcatcgacacaggagtcgtcaaggagcgcatgtacaacgccaag
atcggcattgactcattgacggtggtaccggtctccaaggccgccgctcgccagcgatca
ggacgagcaggacgagagagcgctggcgagtgctatcgtctgtatcgcgaggagagcttt
ctgcgattcgccgagtcgcaggttcccgagatcaaaagagcaaacatggccagcgttgtg
cttcagctcaaagcgctgggcattcaagacgtcacccgattcgactacatggaccctccg
ccgttggacagcctgaaaaagtcaatcgagcttctcacagtgctcggtgctttggacagt
gagaacaagctcacttccccgatcggacggaacatggcagcgctgcctttggatccgcta
ctctccaagacgcttatcatgtccgagaaattcggttgcactgaggaaatcttgatcatc
gtggcgatgctatcgggagagtccatcttcttcgtgccgcggggcgacaagaagaagcaa
gctgagctcgcgcaccggcgcttccactccatcgaaggtgaccacatcacactgctgaac
atctacaaggcctatcagcaagccaccaacaagaacaatttttgttatgagagcttcatc
aactcccgcaccatcaagcacatccaggaggtgtggcggcagctgggcgactactgcaga
cagctcggcattgaacgcaagtcctgcggcgagaacacagagaccatcaggcgctgtctc
acgtcgggcttcttcctcaaggccgccttggccaaaatccatccctcgtctgtgcttttt
accaagaagccgctctgcgttctttacaaccagctggtgatgacaaagcaaaagtacatg
agggaggtggtggttattgaccaaaactggctagtggagcttgctcctaacttctacgcc
aagcgctccgttgtaggttcccacagacagggaaagtag

DBGET integrated database retrieval system