KEGG   Acanthamoeba castellanii: ACA1_054610Help
Entry
ACA1_054610       CDS       T02667                                 

Definition
(RefSeq) Myotubularinrelated protein, putative
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00562  Inositol phosphate metabolism
acan01100  Metabolic pathways
acan04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ACA1_054610
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    ACA1_054610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acan01009]
    ACA1_054610
Enzymes [BR:acan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     ACA1_054610
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     ACA1_054610
Protein phosphatases and associated proteins [BR:acan01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    ACA1_054610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related
Motif
Other DBs
NCBI-GeneID: 14921585
NCBI-ProteinID: XP_004344118
UniProt: L8H6E8
Position
Unknown
AA seq 564 aa AA seqDB search
MEGDGSDERILALAEPFLCGGEQPVMHARVVREQAMRTLLSPPSGASSPALGQLVITNFA
LLFIVERSSTSSSSSSSATKRDVNDLWWNSLDFKVPLGAISRVEAKKDKYVRIHCKDFRL
LQFTMPYTLADPTNTKKQMELTMRKIESTLRMFAFSGKLKNLFAFSHTLSTKHCVNGWDR
ANVRKDLQRMGLPTDKWRISDSNHSYLICPTYPSVFAVPANVSDITLHKVGAFRSKGRIP
ILSWIHPKNEATITRAAQPLVGIGGSRSTEDEHLIKEIIRATPSSALVIMDARPKVNAAA
NKARGAGYETMSHYAGEISGMSEDAIAVAEVEGLEGGIGQSGALEFLGIDNIHVMRDSEK
KLKDICNHLSVQDKGWFTALDNSRWLDFVSLLLACTRRMVLTIEAGISIFTHCSAVDRAD
GWDRTSQLSALAMLCLDPFYRTIEGFATLIEREWLAVGHKFQQRYGHGDKHYDDSNRSPI
FPQFIDCVHQLLHQFPTCFEFNEEFLVTILDALYSCQYGTFLCDSEKDRQAAQLHSKTVS
LWSYTDKHRDRFTSRAYIPYDQVR
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcgatggctcggacgagcggattctggcgctggccgagccctttttgtgcggc
ggcgagcagccggtgatgcacgcccgcgtggtgcgggagcaggccatgcgcacccttctg
tcgccgccctcgggcgcgtcgtccccggcgctcggccagctcgtcatcaccaactttgct
cttctcttcattgttgagcgctcctcgacctcctcctccagctcgagcagcgccacgaaa
cgtgatgtgaacgacttgtggtggaacagcctggattttaaggtgcccctcggcgccatc
agcagggtggaagcaaaaaaggacaagtacgtgcgcatccactgcaaggacttccgcctg
ctccagtttacgatgccctacacccttgctgatccgaccaacaccaagaagcaaatggag
ttgaccatgcgcaagatcgagagcacgcttcgcatgtttgccttctcgggcaagctcaag
aatttatttgccttcagtcacaccctgtccacgaagcactgcgtcaatgggtgggaccgg
gccaacgtcagaaaggatctgcagcggatgggcctccccacggacaagtggcgcatctcc
gactccaaccactcctacctcatctgccccacctacccgtccgtcttcgccgtcccggcc
aacgtcagcgacatcaccctccacaaggtgggtgcgttcaggagcaaggggcggattcct
atattgtcgtggattcaccccaagaacgaggccaccatcacgcgagccgcacagccgctg
gtgggcatcggcggaagccgttcgaccgaagacgagcacctcatcaaggagatcatacgc
gccaccccctcgtcggcgttggttatcatggacgcgcggcccaaggtgaatgctgccgcg
aacaaggcccggggcgctggctacgagacgatgtcgcactatgcgggtgagatcagcgga
atgtccgaggacgcaatcgcagtggccgaggtggagggcctcgagggcggcatcggacag
agcggcgcgctggagttcctggggatcgataatattcacgttatgcgggacagcgagaag
aagctgaaggacatctgcaaccacctcagcgttcaagacaagggctggttcaccgccctc
gacaactctcggtggctcgatttcgtctcgctgctgctggcctgcacacgccggatggtg
ctcaccatcgaggccggcatctccattttcacacactgctccgctgtcgatcgagcagat
ggctgggaccgcacgtcgcagctgtcggcgctggccatgctctgcctcgacccgttctac
cgcaccatcgaaggtttcgccaccttgatcgagcgcgagtggctcgccgttgggcacaag
tttcagcaacggtatgggcacggtgacaagcactacgacgacagtaatcggtcgcccatc
ttcccccaattcatcgactgcgtgcaccagctgcttcatcaatttcccacatgctttgaa
ttcaacgaggaattcctggtgacgattttggacgccctatactcgtgccagtacggcact
ttcctgtgcgactcagagaaggaccggcaagcggcgcagctccactcgaagaccgtctcc
ctgtggagctacacggacaagcacagggacaggttcacctcgcgcgcgtacatcccctac
gatcaggtacggtag

DBGET integrated database retrieval system