KEGG   Acanthamoeba castellanii: ACA1_072800Help
Entry
ACA1_072800       CDS       T02667                                 

Definition
(RefSeq) methionine-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00450  Selenocompound metabolism
acan00970  Aminoacyl-tRNA biosynthesis
acan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ACA1_072800
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACA1_072800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acan01007]
    ACA1_072800
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acan03016]
    ACA1_072800
Enzymes [BR:acan01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ACA1_072800
Amino acid related enzymes [BR:acan01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ACA1_072800
Transfer RNA biogenesis [BR:acan03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ACA1_072800
 Prokaryotic type
   Other AARSs
    ACA1_072800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 14924629
NCBI-ProteinID: XP_004353175
UniProt: L8HEJ9
Position
Unknown
AA seq 542 aa AA seqDB search
MVTTPIFYVNGSPHIGHLYSALVADALARWHRMLGASTLFVTGTDEHGLKIQEAAKGKGK
TPAQFCDEVSEEFRSLMVQADISNDQFIRTTEERHKKAVHALWKLLEDRGYIYKGKYEGW
YCVSDEAFLTPVQVADGTATIKPSDTAGPWQLLTTWRIEQPGVDKQGNPCKVSLESGHVV
EWVVEENYKFKLSAFQKPLLRWLENTDQGGSVIPRVRANELFGLLRERELQDLSISRIGS
RIKWGIPVPSDDGHTIYVWLDALTNYLTAAGFPWDGEASAAMSVPPSSAWPADYHIIGKD
IIRFHTIYWIAFLMAAELPLPKKIVAHAHWTVNRHKMSKSLGNVVTPNEIIGKYGLDPVR
YFLLRDGGMVDDGDFSHETLVSKLNNDLADTLGNLFARLTAPSLNPAGLVPACGDLTADD
QAFVDRMQRLPDRVSEHYTNVEFGPGISAIFEILYDANKYLQDNEPWKLRKTDPRRCETV
LYVALEAARLSALLLQPIMPRSAAKMLDMLGVAADERSAQALTYGRQPGAKLVKEILFTK
VK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaacgcccatattctacgtcaacgggagcccacacatcggacacctctattcg
gcgctcgtggccgacgccctggcccgctggcaccgcatgctgggcgcctccaccctcttc
gtcactggcaccgacgaacacggcctcaagatacaagaggcggccaaggggaaggggaag
acgcctgcccagttctgcgatgaggtgtcggaagagttcaggagcctgatggtgcaggcg
gatatctccaacgaccagttcatccgcaccaccgaggagcgccacaaaaaggccgtacat
gcgctgtggaagctgctcgaggatcgagggtacatctacaagggcaagtatgagggatgg
tattgtgtgtcggacgaagcctttctcacgccggtgcaagtggccgatggtactgccacc
atcaagccaagcgacaccgctgggccatggcaactgctgacgacgtggcgtattgaacaa
ccaggagtggacaagcaggggaatccgtgcaaggtctcgctcgagagcgggcatgtggtg
gagtgggtggtagaagagaactacaagttcaagctgtcggccttccagaagccactgctt
cgatggctggaaaacacagaccaaggcggctccgtcattcctcgcgtgcgagccaacgag
ctctttggccttctgcgggaaagggagttgcaggatctgtccatctcgcgaattggaagc
agaatcaagtggggcatcccggtgccaagcgatgacgggcacaccatctacgtctggctc
gacgcgctcaccaactatctcaccgcagccggtttcccctgggacggcgaggcctccgcg
gcgatgtcggttcctccctcgagcgcgtggccggccgactaccacatcatcggaaaggac
attatccgcttccacaccatctactggattgcgttcctgatggccgccgaactgccccta
ccgaagaagatcgtggcccatgcccactggactgtgaaccggcacaagatgtccaagagt
ctgggcaatgtcgtcacgcctaatgagattattggcaagtacggacttgaccccgtacga
tatttcctgctgcgcgacggtggcatggtggacgacggcgacttctcccacgagacgctc
gtctccaagctcaacaatgatcttgccgacacactcggcaacctatttgcgcgcctcacg
gccccgagcctcaacccagcgggcctcgtccccgcgtgcggcgatctcacagccgacgac
caggccttcgtcgaccgaatgcagcgtctccctgatcgggtaagcgagcactacaccaac
gttgagttcgggccgggcatcagtgcgatcttcgagatcctctacgacgccaataagtac
ttgcaggacaacgagccgtggaagctgcgcaagactgacccccggcgctgcgagacggtg
ctgtacgtggcgctcgaggccgcccggctgtcggcgctcctgctgcagcccatcatgccg
cggtcggccgccaagatgctcgacatgctgggcgtcgccgccgacgaacggagcgcgcaa
gccctcacctacggccggcaacccggcgccaagctggtcaaggagatcctcttcaccaaa
gtcaagtga

DBGET integrated database retrieval system