KEGG   Acanthamoeba castellanii: ACA1_095590Help
Entry
ACA1_095590       CDS       T02667                                 

Definition
(RefSeq) tRNAdihydrouridine synthase 1-like protein
  KO
K05542  tRNA-dihydrouridine synthase 1 [EC:1.3.1.88]
Organism
acan  Acanthamoeba castellanii
Brite
KEGG Orthology (KO) [BR:acan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acan03016]
    ACA1_095590
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.88  tRNA-dihydrouridine16/17 synthase [NAD(P)+]
     ACA1_095590
Transfer RNA biogenesis [BR:acan03016]
 Eukaryotic type
  tRNA modification factors
   Dihydorouridine synthases
    ACA1_095590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dus His_biosynth
Motif
Other DBs
NCBI-GeneID: 14913252
NCBI-ProteinID: XP_004334922
UniProt: L8GJ81
Position
Unknown
AA seq 430 aa AA seqDB search
MEAPVPSGTTEAKIVVVTEDGDTNQKQPQSSSSAADGVSPSLHVREDREEVVARASRLAE
ELATQWQGGFTLSAPRVRPQPGAADPFTFYTAVLRRPRLVLAPMVDMSELPFRMLCRKYG
AELCYTPMYHSRLFAEEAKYRQMEFSTCPEDRPLVVQFCGNDPEVLLKAAKFVENDCDAV
DLNLGCPQGIAKRGNYGSFLLDKCYWPLLYAMVRKLYENLKVPVFCKIRLLPSLDDTLQL
ARMLQDAGCQLLAVHGRTRDNKGLYCTPADWDSIRIVKEALAIPVIANGNIAQFEDIEPC
LEATRCEGVMAAWAALNNPALFSGQVPDKVALAIEYLDMCEAYPTQPKSIRAHLCKLLKK
QFQIHEDLRERMLTHTKTLPAIRTLVETLKHRLDNDIPPVLRPPKEQIEEVDDGEAMEGG
ALFAQDDDEF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcccgtgcccagcggaacaacagaggcgaaaattgttgttgtgaccgaggat
ggcgatactaatcagaagcagccgcaatcatcatcatcggctgccgacggagtctcgccg
tccctccatgtgagagaagatcgcgaggaggtcgtggcccgcgcctcgcgcctggcagaa
gagctggccacccaatggcagggcggcttcaccctctccgctccgcgcgtacggccccag
cctggcgccgccgatcccttcaccttctacacagcggtcctccgccgaccccggctcgtc
ctcgcgcccatggtggacatgagcgagctgccgtttcgtatgctgtgccgcaagtacggc
gccgagctgtgctacacgcccatgtaccactcgcgcttgttcgccgaggaggccaagtac
cgacagatggagttctccacgtgccccgaagatcggccgctcgtggtgcagttctgcggc
aacgatccggaggtgctgctgaaggccgccaagttcgtcgagaacgactgcgacgccgtc
gacctgaacctgggctgtccgcagggcatcgccaagcggggcaactacgggtctttcctc
ctcgacaagtgctactggcccctcctctacgccatggtgcgtaagctgtacgagaacctg
aaggtgccggtgttctgcaagatccggctgctcccgtcgctggacgacaccctccagctg
gcccgcatgctgcaggacgccggctgccagctgctcgccgtccacggccgcacgcgggac
aacaagggcctctactgcacccccgccgactgggactccatccgcatcgtcaaggaggcg
ctggcgattccggtgatcgccaacggaaacatcgcgcagttcgaagacatcgagccgtgc
ctggaggcgacgcggtgcgagggcgtgatggcggcgtgggcggccctgaacaacccggcc
ctgttctcgggccaggtgccggacaaggtggccctcgccatcgaatacctcgacatgtgc
gaggcctaccccacccagcccaagagcatccgcgcccacctctgcaaactcctcaagaag
cagttccagatccacgaggacctccgcgagcgcatgctcacgcacaccaagacgctgccg
gccatccgtacgctcgtggagacgctcaagcaccgcctcgacaacgatatcccgccggtg
ctgcggccgcccaaggagcagatcgaggaggtggacgacggcgaggccatggagggaggt
gcgctcttcgcgcaggacgacgacgagttctag

DBGET integrated database retrieval system