KEGG   Acanthamoeba castellanii: ACA1_108300Help
Entry
ACA1_108300       CDS       T02667                                 

Definition
(RefSeq) Poly(ADPribose) polymerase catalytic domain containing protein
  KO
K00774  poly [ADP-ribose] polymerase 16 [EC:2.4.2.30]
Organism
acan  Acanthamoeba castellanii
Brite
KEGG Orthology (KO) [BR:acan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACA1_108300
Enzymes [BR:acan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     ACA1_108300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP Exotox-A_cataly
Motif
Other DBs
NCBI-GeneID: 14911191
NCBI-ProteinID: XP_004332806
UniProt: L8GDJ5
Position
Unknown
AA seq 291 aa AA seqDB search
MESETSEVAASPASEEVLQRRDLEVNILQTLPPLSTLARDEESVHKLPLKSLRFLDWLFH
PPAFRLKEITVDEFNVKTSFHSETAGAARSGSLPQHIFEVVYDESPSSSTSGAASFALEA
LQRYQSVAQKHGTVVGYHASSLENFHSILWNGLDTKYSKQGLFGEGIYLSTDASVCMTFW
TSAPSWERSAIGPRVGLIAGCEVANDPEYVSHGKRETNDASLPEQYLLSKSNDHVRVKYL
LVLSEAHKPKAPQRKINRNALVIFLFVLLLAFVAFLRSPAWKRLRNKWLGR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgaaacgagcgaggtggctgcgtcaccggcttcggaggaggtgctgcaaagg
agggacttggaggtaaatatcctgcaaacgctgcctcccctgagcacacttgctcgtgat
gaggagtctgtgcacaagctgccgctcaagtcgttgcgattcctcgactggctgttccac
ccaccagctttccgattgaaagagatcactgtagacgagttcaacgtcaagacctccttc
cattccgaaaccgctggtgctgcccgctcgggctccctgccacaacacatcttcgaggtc
gtctacgacgagtccccttcgtcctccacttctggcgcagcatcgtttgccttggaagca
ctgcagcggtatcagtctgtggctcagaagcacggcacggtggtggggtaccatgcttcg
tcgctcgagaactttcactccatattgtggaacgggctcgacaccaagtactccaagcag
ggcctctttggcgaggggatctacctctccaccgacgcctccgtgtgcatgaccttctgg
acctcggctccttcgtgggaaaggagcgcgatcggccctcgagttggccttattgctgga
tgtgaggtggccaacgaccccgagtacgtgtctcacggcaagcgggagacgaacgacgcg
agtttacccgagcagtatctgctctcaaaaagcaatgaccatgtccgcgtgaagtacctg
ctcgtactctcggaggcacacaagcccaaagcgccgcagaggaagatcaataggaacgct
ctcgtgatcttccttttcgtgcttctcctcgcctttgtcgcctttctccgatctcccgct
tggaaacgcctccgtaacaagtggctcggccgctga

DBGET integrated database retrieval system