KEGG   Acanthamoeba castellanii: ACA1_181240Help
Entry
ACA1_181240       CDS       T02667                                 

Definition
(RefSeq) 4nitrophenylphosphatase-like protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     ACA1_181240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 GBR_NSP5
Motif
Other DBs
NCBI-GeneID: 14911240
NCBI-ProteinID: XP_004332884
UniProt: L8GFB0
Position
Unknown
AA seq 306 aa AA seqDB search
MKSNQVQKVSDVPKFLDSFDTFLLDCDGVLWRGSTLLPHTKEVLQQLRSMGKRLLFVTNN
STKSREDYKKVFAKFGIEVSADEVISSSSAVAHYLKDEAHFTKTAYVVGEAGITRELDAL
GISWIGGVDHKENMTMQELEHIELDPRIGAVVVGLDTNINYRKVAYAQLHLRNRPETLFL
ATNADSTFPSAGHMLPGSGTMVAMVEACSGRKALVIGKPSKTLIDLVVHQYGLDKERTCM
VGDRLNTDIQFGLNGGISTLLVLTGVTTEEELMSPDNPTHPHHYIPAFGDLLLASSSSHL
LLRNTT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaaccaagtccagaaagtgtcggacgtgcccaagttcctcgactcgttcgat
accttccttctggattgtgatggcgtgttgtggcgaggctcaaccctgttgccgcacacc
aaggaagtcctccagcagcttcgctccatgggcaagcgtctgttgtttgtgacgaacaac
agcaccaagtcgcgcgaggactacaagaaggtgtttgccaagttcgggatcgaggtgtcg
gccgacgaggtcatctcgtcgtcgtcggccgtcgcccactacctcaaggacgaggcccac
ttcaccaaaaccgcctacgtcgtcggcgaggccggcatcacccgcgagctcgacgccctg
ggcatctcctggatcggcggtgtcgaccacaaggagaacatgaccatgcaggagctggag
cacattgaacttgatcctcggatcggagctgtggtggtcgggctggacaccaacatcaac
taccggaaggtcgcctacgcgcagctccacctccgaaaccgccccgagaccctcttcctc
gctaccaacgccgattccaccttcccctccgctggccacatgctgcccggctctggcacg
atggtggccatggtggaggcgtgtagcggccgcaaggcgttggttatcggcaagcccagc
aagaccctgatcgatctcgtcgtccaccagtacggcctcgacaaggagcgcacgtgcatg
gtgggcgaccggctcaacaccgacatccagttcggcctcaacggcggcatctctacgctg
ctcgtcttgaccggcgtcaccaccgaagaagagctcatgagccccgacaaccccactcac
cctcaccactacattcccgcctttggcgatctccttcttgcctcgtcttcttctcatctt
cttcttcgtaatacaacgtaa

DBGET integrated database retrieval system