KEGG   Acanthamoeba castellanii: ACA1_182320Help
Entry
ACA1_182320       CDS       T02667                                 

Definition
(RefSeq) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00230  Purine metabolism
acan00250  Alanine, aspartate and glutamate metabolism
acan01100  Metabolic pathways
Module
acan_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ACA1_182320
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACA1_182320
Enzymes [BR:acan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     ACA1_182320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 14922220
NCBI-ProteinID: XP_004345874
UniProt: L8H841
Position
Unknown
AA seq 533 aa AA seqDB search
MRAFFGSTSPSAARCAVGQEISNISHAHTISFPFFWASQAGRTAVLSRNLAARNYSTATS
TTTTEEAAPAAAVATPAAEAVEKPKVEEPKPATPKVEKKGNISRVAAEQVIAVMGGQWGD
EGKGKLVDVLGANFDIIARCAGGSNAGHTVIVEGKKYAFHLLPSGILHERPVCLIGNGTV
VHVPTLLKELTSLDEKGVNYKGRVKLSDRAHVVFDFHQQIDAFLEDAAKKGNKDGSIGTT
RKGIGPAYGAKIGRVGIRVGDLRFPDTLPEKLTKLVEYYQRSFPLEVNLNHEIEAYKAFA
HKLQPMIVDSVHYINKAYGEGKRIMVEGANATMLDIDFGTWPYVTSSNASIGGAVTGLGL
APSKIDGVIGIVKAYTTRVGAGPFPTELKDDLGESIRKIGHEFGTTTGRPRRCGWLDAFA
IKYAHMINNFTLLNLTKLDVLSDLDEIKIATSYKYNGEHLASYPSNLEILDQVEVEYETL
PGWKKDVSGVRYFEDLPAEARKYVERVEQLVGCPIGWVGVGPGREAMAIRKPK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctttcttcggcagcacctctccatcggcggcgcgttgtgccgtgggccaggaa
attagcaacatctcgcatgctcacaccatttcctttccattcttttgggcctcacaagcc
ggccgcaccgctgtgctgagccgcaacctggccgcgagaaactactcgaccgccacctcc
accaccaccaccgaggaggccgccccggcagctgcggtcgccaccccggccgccgaggcc
gtggagaagcccaaggtcgaggagccgaagcccgccacgcccaaggtcgagaaaaaaggt
aatatctcgcgggtggcggccgagcaggtgatcgccgtgatgggcggccagtggggcgat
gagggcaagggcaagctggtcgacgtcctcggcgccaactttgacatcatcgcacgctgc
gccggcggctccaacgccggacacactgtgatcgtggaggggaagaagtacgcgttccat
ctgctgccgtcgggcatcctgcacgagcgccccgtgtgcctgatcggcaacggcacggtg
gtgcacgtgcccacgctcctcaaggagctcacgtcgctcgatgagaagggcgtcaactac
aagggacgcgtcaagctctccgaccgcgcccacgtcgtgttcgacttccaccagcagatc
gacgccttcctcgaagacgccgccaagaagggcaacaaggatgggtcgattggcacgaca
cgcaagggcatcggaccggcgtacggggccaagatcggtcgggtgggcattcgcgtgggc
gacctgcgcttccccgacacgctgccggagaagctgaccaagctcgtcgagtactaccag
cgctcgttcccgctcgaggtcaacctcaaccacgagatcgaggcctacaaggccttcgcc
cacaagcttcagccgatgatcgtggacagcgtgcactacatcaacaaagcctacggcgag
ggcaagcgcatcatggtggagggcgccaatgccaccatgctcgacatcgactttggcacg
tggccctacgtcacctcctccaacgcctccatcggcggcgccgtcaccggtctgggtctg
gcgccgagcaagatcgacggcgtgatcggtatcgtgaaggcctacaccacgcgcgtgggc
gcgggtccgttcccgacggagctcaaggacgacctgggcgagagcatccgcaaaatcggc
cacgagttcggcaccaccaccggccggccccgtcgatgcggttggctcgacgcctttgcc
ataaaatatgcgcacatgatcaacaacttcacgctgttgaacctgaccaagctggacgtg
ctgtccgaccttgatgagatcaagatcgccacgtcgtacaagtacaacggagagcacctc
gcatcgtatccgtccaacctggagatcctggaccaggtcgaggtcgagtacgagacgctg
cccggctggaagaaggacgtctctggcgtcaggtactttgaggatcttcccgcggaggcc
cgcaagtacgtcgagcgagtggagcagctcgtgggctgcccgatcggttgggtgggcgtg
ggaccaggtcgcgaggccatggccatccggaagcccaagtag

DBGET integrated database retrieval system