KEGG   Acanthamoeba castellanii: ACA1_184440Help
Entry
ACA1_184440       CDS       T02667                                 

Definition
(RefSeq) soluble guanylyl cyclase beta1 subunit, putative
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00230  Purine metabolism
acan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ACA1_184440
Enzymes [BR:acan01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     ACA1_184440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOB HNOBA TFIIA
Motif
Other DBs
NCBI-GeneID: 14922392
NCBI-ProteinID: XP_004346041
UniProt: L8H8D6
Position
Unknown
AA seq 674 aa AA seqDB search
MYGLINKAVRALIVSHYGEATWLEIVKLAGCQALFISNTSYPDETTYALVGAASEVLKVP
APDLLERVGLYWVSYTRQHGYKSLFDIGGSSLPEFLCNLNAMHTHIQAQFPKLRMPTFWC
TDIAPQSLTLHYRPGRPTRNGLAPLVVGLMKGLADLFHLEEFEIEHTGKRSHHGADDDDG
GADFDVFLLRWEGEPSSLDSSIGGMPLLATATRADLSASTASIPDYSGECPAPAGSDEND
KLRAFEARWQFCLPPTRFAAAFPFHLVLSQDLKIVQAGEVLQRLCPEMALGSDFGQHWRV
VRPEMVVPVPQPRGHGTHHSEPEAHNGGEGETRDKSDNGGVSFQAIKDNRDLLFLLESKH
NKRLKLRGQMNVISSTEGCQVSNSGGTLRRKAQPPPPPPQQQQPTQQSHTRERRQTPRSP
RCPMSLAASPRRSTTLSVSPACASSASATATPPGGCPMTSLMSSSSSTSVGRRKKKTLRS
ISDPATDGKKKRSSTDRARRPEEDDSDLTDSNRSVICAPPAEETIIKADGDDGNKPTVVV
AAADHYKQHKTKKSSKRARAKQTLRLEEFVFFLGSVQVKDNEEVVELGLSLHDFALHDAV
KEVLVLAASNETTMRDVHQMEEFILYGMDGGSGAAGAGGARKGDPYDDSAISGSGRRPSI
KPNGHTKNTRCLLS
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggctcatcaataaggcagtgcgagcactaattgtgtcgcactatggggaggcg
acgtggctcgagatagtcaaactcgccggctgccaggccctcttcatctccaacacttcc
taccccgacgaaaccacctacgcgttggtgggtgctgcgagcgaggtgttgaaggtgccg
gcgcctgacctgctcgagcgggtgggcctttactgggtctcctacacacgtcaacatggc
tacaaatctctcttcgatatcggagggtcatcgctgcccgaatttctatgcaacctgaac
gccatgcacacgcacatccaggcccagttccccaagctgcgcatgcccaccttctggtgc
accgacatcgcgccccagtccctcaccctgcactaccggcccgggcggcccacgcgcaac
ggcctcgccccgctcgtcgtgggcctcatgaagggcctcgccgacctctttcatctcgag
gagttcgagatcgagcacaccggcaagcgcagccaccacggcgccgacgacgacgacgga
ggagccgacttcgacgtctttctcctgcgctgggagggcgagccgtcctcgctggactcc
agcatcggtggcatgccgttgctcgccaccgccacccgcgcagacctcagcgcctcgacc
gcgtcgattcccgactacagtggcgaatgcccggccccggccggcagcgacgagaacgac
aagctgcgcgcgttcgaggcccgctggcagttctgcctgccgccgactcgcttcgcggcg
gcgttccccttccacctggtgctgtcgcaggacctcaagatcgtgcaggccggcgaggtc
ctccagcgcctgtgtccggagatggccctcggctccgactttggccagcactggcgcgtc
gtgcggcccgagatggtcgtgcccgtaccgcagccgcgcggccatggcactcaccacagc
gagcctgaggcccacaacggcggggaaggggagacgcgcgacaagagcgacaacggtggc
gtgagcttccaggcgatcaaggacaacagggatctgctgttcctgctcgagtcgaagcac
aacaagcgactcaagctgcgcgggcagatgaacgtcatctcttcgacagagggctgccag
gtcagcaacagcggcgggacgctccggaggaaggcccagccgccgccgccgccgccgcag
cagcagcagcctacacagcagtcccacactcgcgagcgtcggcaaacgccgaggtcgccc
cggtgtcccatgtctttggcggccagcccgcgcagatcgaccactttatccgtgtcgcct
gcctgtgcatcgagcgccagcgcaaccgcaacgccgcccggtgggtgtccgatgacgtcg
ctcatgtcgtcatcctcgtcgaccagcgttggtcgccgcaagaagaagactctgcgcagc
atatccgacccggccacagacggcaagaagaagaggagctccacggaccgagcgcgcagg
cccgaggaggacgattccgacctcaccgacagcaaccggagcgtcatctgcgcgccgccc
gcggaggagaccatcatcaaggccgacggcgacgatggcaacaaaccgacggtcgtggtg
gcagccgccgatcattacaagcagcacaagacgaagaagagcagcaagcgcgcgagggcc
aagcagacgctcaggctcgaggagttcgtgttcttcctgggcagcgtgcaggtcaaggac
aacgaggaggtggtcgagctgggcctctccctccacgactttgccctccacgacgcggtc
aaggaggtgctcgtgctcgcggcctccaacgagacgaccatgcgagacgtccaccagatg
gaggagttcatcctctacggcatggacggcggcagtggtgccgccggtgcgggtggcgcc
aggaaaggcgacccctacgatgacagcgccatcagcggcagtggtcgacgcccgtccatc
aagcccaacggccacaccaagaacaccaggtgcctcctcagctga

DBGET integrated database retrieval system