KEGG   Acanthamoeba castellanii: ACA1_205990Help
Entry
ACA1_205990       CDS       T02667                                 

Definition
(RefSeq) histidine acid phosphatase superfamily protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00010  Glycolysis / Gluconeogenesis
acan00562  Inositol phosphate metabolism
acan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACA1_205990
   00562 Inositol phosphate metabolism
    ACA1_205990
Enzymes [BR:acan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     ACA1_205990
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     ACA1_205990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Kinase-PolyVal
Motif
Other DBs
NCBI-GeneID: 14921317
NCBI-ProteinID: XP_004367485
UniProt: L8H5L5
Position
Unknown
AA seq 490 aa AA seqDB search
MMKVAITLSIVLLLGVVVVSAVGDFDIRYHLGSKTPYWPQQNDTTYTPPPDGCHPQFNKF
HGILQGHHDAMGAYPWMRNWTNPFDLEDADYLTVQGEYEHYYMAKRALAFYKDLLGTCPF
EPSRYDIHSTEISRAGMSASAYSFGLFEKRGQVGPTDFDPFFIVTNNATTDNELRFFKTC
PNYISGVKKNKKASAESQFYANKQLPGLADKLTKRINVAGWTLTTDDVNTLWTLCVFQLS
AQEISDQFCSFFDKDDVGIMNYIDDLSSYWVKGYGYPINYEISCVLMQNFVDAITQVTSN
PVDTHSLRATLRFAHAETVMPFLSLLGLFNDSVPLRATNTQEQIDNRLWRQSIISTFAAN
VALVTYNCSKPSGPADFRVKLFHSEKEYQIPQCDNKLYCPFEKFKEIYARSLTCDFNKLC
GIEGCPANSDADDPTKLLSHKTVIILVVCVGAGGIIVGALALTAVLCVVRCFRRRHEEQG
YELAADSVIL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggtcgcgattaccctcagcatcgtactgttgcttggggtggtggttgtgtct
gctgtgggggacttcgacattcgctaccacctcggatcgaagacaccctattggccccaa
caaaatgacacgacctacacgcccccgcccgatggctgccaccctcagttcaacaagttt
cacggtatcttgcaggggcaccacgatgccatgggagcctacccttggatgcggaactgg
accaaccctttcgacctggaggatgccgactacctcaccgtgcaaggcgagtacgagcac
tactacatggccaagcgtgcactcgccttctacaaggacctgctcggcacctgccccttc
gagccctcgcgctacgatatccactcgaccgagatctctcgcgcgggcatgagcgccagc
gcctacagcttcggtctgtttgagaagcgtggccaagtcggaccgacggactttgacccc
ttcttcatcgtgaccaacaacgcgacgaccgacaacgagctgcgtttcttcaagacctgc
cccaactacatcagtggcgtcaagaagaacaagaaagcctctgccgagagtcagttctac
gcgaataagcagctgcccggtctggccgacaagctcaccaagaggatcaacgtcgccggg
tggacactcaccaccgacgacgtcaacaccctgtggaccctgtgcgtcttccagctctcc
gcccaggagatatcagaccagttctgcagcttcttcgacaaggacgatgtgggcatcatg
aactacatcgacgatctgtcgtcgtactgggtcaagggctacggctatcctatcaactac
gaaatctcctgcgtcctcatgcagaactttgtggacgccatcacccaagtgaccagcaac
cccgtggacacgcattcgctgcgggccaccctgcgtttcgctcacgccgagaccgtaatg
cctttcctaagtctgctgggcctgttcaacgacagcgttcccctccgagccaccaacacc
caggagcagattgacaaccgcctctggcgccagagcattatttcgacctttgctgccaac
gtggccctggtcacttacaactgctccaagcccagcggtcccgctgatttccgtgtgaag
ctgttccacagcgagaaggagtaccagatcccccaatgcgacaacaagctctactgtccg
tttgagaagttcaaggagatctacgcccgttcgctgacctgcgacttcaacaagctgtgc
ggcatcgagggctgtcccgcaaacagcgacgccgacgacccgaccaagctcctgagccac
aagactgtgatcatcctcgtcgtgtgcgtcggcgccggcggaatcatcgtgggcgccctg
gcgcttaccgccgtactctgcgtcgtgcgatgcttccggcgaaggcacgaggagcaaggt
tacgaacttgccgcggactcagtcatcctctaa

DBGET integrated database retrieval system