KEGG   Acanthamoeba castellanii: ACA1_220070
Entry
ACA1_220070       CDS       T02667                                 

Definition
(RefSeq) ergosterol biosynthesis erg4/erg24 family protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00100  Steroid biosynthesis
acan01100  Metabolic pathways
acan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    ACA1_220070
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     ACA1_220070
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 14915872
NCBI-ProteinID: XP_004337283
UniProt: L8GQK3
Position
Unknown
AA seq 392 aa
MQEGSVVPATVVTGYACDRQGKVLVYRLNGLRVLFVVVLAFVGLSYANVIDGEYLANNIW
PCFHAGNIYGLLCSFIFYIKGKRLPPDQRDVGRRAITVDQVKHKKEEEEDKATKKSSGTK
APSTPSPSSSGGVGSFLMDFYAGLEFNPRLGLFDHKMFLYLVGAVVLECVLVSAAITQYH
ALGGRLSLGLTTYLLLFSFFVAEYMYHEHVHLYTYDLFAERVGFKLIWGCLCFYPFFYGI
GVWPLLARGPDQQDTTAPHAALAALCFFGGWALSRGANNQKYAFKTGPPNAPFLGIAPRV
VPGSRILCSGWWGLARHINYLGEILMAIGLALPGGGAGAGWSALLPWLYPLYYVALLFPR
EREDSRVCELKYGQAWRDYCRAVPYRIIPYLY
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgcaagaaggaagtgtggtgccagcgacggtggtgactggctacgcgtgcgataggcag
ggcaaggtgctcgtgtaccgcctcaacggtctgcgagtcctcttcgtcgtagtgctggcc
ttcgtgggcctgtcgtacgccaatgttatcgacggggagtacctggccaacaacatatgg
ccctgcttccacgccggcaacatctacggcctcttgtgctccttcatcttctacatcaaa
gggaagcgtttgccgcccgaccagcgagacgtggggcgtagggccatcaccgtagaccaa
gtcaagcacaagaaggaagaagaagaagacaaagctacaaagaagtcgagcggcaccaag
gcaccatccacgccgtcgccgtcttccagtggtggggtcggctcgttcctgatggacttc
tacgccgggctggagttcaacccgcgcctggggctgttcgaccacaagatgttcctctac
ctcgtgggcgccgtggtgctcgagtgcgtcctggtctcggccgccatcacgcagtaccac
gccctcgggggtcgtctgtcgctcgggctcaccacctacctcctcctcttctccttcttc
gtcgccgagtacatgtatcacgagcacgtgcacttgtacacgtacgatctgttcgcagag
cgggtggggttcaagctcatctggggctgcctgtgcttctaccccttcttctacggcatc
ggcgtgtggcccctcctcgcgcgcggccccgaccaacaagacaccaccgccccgcacgcc
gccctcgccgccctctgcttcttcggcggctgggcgctctcgcgcggggccaacaaccaa
aagtacgctttcaagaccgggccgcccaacgcgccgttcctgggcatcgcgccccgcgtg
gtccccggctcgcgcatcctgtgctcgggctggtggggcctggcccgccacatcaactac
ctgggcgagatcctgatggccatcgggctggccctccccggcggcggcgcgggcgcgggg
tggtcggccctgctgccctggctctacccgctctactacgtcgcgctgctgttcccgcgc
gagcgggaggacagccgggtgtgcgagctcaagtacgggcaggcctggcgggactactgc
cgcgccgtgccctaccgcatcatcccctacctctactag

DBGET integrated database retrieval system