KEGG   Acanthamoeba castellanii: ACA1_289680Help
Entry
ACA1_289680       CDS       T02667                                 

Definition
(RefSeq) hypothetical protein
  KO
K10277  lysine-specific demethylase 8 [EC:1.14.11.27]
Organism
acan  Acanthamoeba castellanii
Brite
KEGG Orthology (KO) [BR:acan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acan03036]
    ACA1_289680
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone H3]-dimethyl-L-lysine36 demethylase
     ACA1_289680
Chromosome and associated proteins [BR:acan03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    ACA1_289680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 Cupin_4 Cupin_2 JmjC
Motif
Other DBs
NCBI-GeneID: 14926260
NCBI-ProteinID: XP_004367970
UniProt: L8HJ54
Position
Unknown
AA seq 292 aa AA seqDB search
MSKVARRLASCVGRSSLVAAHTARPFSSLAQAENGQSAQVPRVENVELERFEMDYMKAEQ
PVVLTQAIDHWPALRLWADLDHLRRRATTDAAEPSDEVVVPIEQGSTYLDPEMEHRHVSF
TSYLDNLEKAERGTDTASTGGRSQGAAVGYLAQFRLFDAIPSLQQDFEIPAFCRLGRGDY
YGTHAWLGPQGTVSPLHKDPYHNCLAQVVGSKYIRIYHPRHQACLYPFADFTRKNSSQVD
AENPNLDYYPRFADAPYLECVLGAGQMLYIPKGHWHYVRSLSRSFSISFWWQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtggcgaggaggcttgcgagttgcgtggggcggtcctcgcttgtggctgcc
catacggcacgacccttctcctcacttgcccaagcagaaaatgggcaatctgcacaagtt
ccgagggtagaaaatgtagagctggaacgatttgagatggattacatgaaggcagaacag
ccagtcgtgctcacgcaggcaatcgatcactggcccgccctgcgattatgggccgatctc
gaccacttgcgacggagagccacaacagatgccgctgaaccctcggacgaggtggtggtg
cccattgagcagggatcaacctatttggatcccgaaatggagcatcgtcacgtctccttc
acctcgtacctcgacaacctcgagaaggctgagcgaggcacagacacagcatcgaccggc
gggcgcagtcagggcgcggccgtgggctacttggcccagttccgactgttcgatgccatc
ccctctcttcaacaggactttgagattcccgccttctgtcgtctgggccgaggcgactac
tacggcactcacgcttggctcggacctcagggaacggtgagcccgttgcacaaggacccg
taccacaactgtctggcgcaagtggtgggtagcaagtacattcgcatctaccacccgcgc
catcaagcgtgcctctacccctttgccgacttcaccagaaagaactcgtctcaggtcgat
gcagagaatcccaacctggactactacccacgctttgccgacgcgccctacctcgagtgc
gtgctcggtgccggccaaatgctgtacattcccaagggccactggcactatgtccggtca
ttgtcgcgaagcttctccatcagtttctggtggcaatag

DBGET integrated database retrieval system